SimulationCraft 902-01

for World of Warcraft 9.0.2.36599 Live (wow build level 36599)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 9304 dps, 5044 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9303.5 9303.5 17.6 / 0.189% 757.7 / 8.1% 19.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.7 404.7 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 9304
Cataclysm 780 8.4% 9.7 32.37sec 24127 14200 Direct 29.1 6707 13410 8040 19.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 29.05 0.00 0.00 1.6992 0.0000 233662.87 233662.87 0.00% 14200.11 14200.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.08% 23.27 13 32 6706.53 6142 7261 6707.32 6469 6898 156058 156058 0.00%
crit 19.92% 5.79 1 13 13409.84 12283 14521 13402.29 12313 14392 77605 77605 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.74
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1000) 0.0% (10.8%) 11.9 25.76sec 25087 9270

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.94 0.00 178.39 0.00 2.7065 0.1643 0.00 0.00 0.00% 9269.66 9269.66

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.93
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1000 10.8% 0.0 0.00sec 0 0 Direct 535.2 469 938 560 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 535.16 0.00 0.00 0.0000 0.0000 299502.56 299502.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 432.08 313 569 469.48 263 976 469.61 447 503 202846 202846 0.00%
crit 19.26% 103.08 63 144 938.33 525 1952 938.14 792 1071 96657 96657 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1128 (1499) 12.1% (16.1%) 18.8 15.47sec 23876 12013 Direct 37.4 (73.7) 0 9029 9029 100.0% (60.3%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.77 37.37 0.00 0.00 1.9875 0.0000 337436.31 337436.31 0.00% 12013.36 12013.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.37 26 54 9028.86 5862 12241 9029.18 8807 9267 337436 337436 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.85
  • if_expr:cast_time<havoc_remains
    Internal Combustion 371 4.0% 36.3 15.45sec 3050 0 Direct 36.3 2554 5101 3050 19.5%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.33 36.32 0.00 0.00 0.0000 0.0000 110782.10 110782.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 29.23 17 41 2553.75 1 3715 2555.96 2262 2877 74647 74647 0.00%
crit 19.52% 7.09 1 17 5100.80 50 7428 5100.02 2625 6771 36136 36136 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 793 8.5% 36.8 7.94sec 6447 5160 Direct 54.9 3614 7255 4319 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.80 54.94 0.00 0.00 1.2494 0.0000 237264.96 237264.96 0.00% 5159.73 5159.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 44.32 29 60 3614.06 2047 5042 3614.63 3429 3885 160162 160162 0.00%
crit 19.34% 10.62 2 21 7254.80 4095 10084 7263.98 5585 9163 77103 77103 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.67
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.13
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1589 17.1% 25.3 11.44sec 18815 14944 Direct 31.5 1516 3026 1805 19.1%
Periodic 345.9 1015 2031 1211 19.3% 95.6%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.29 31.51 345.93 345.93 1.2591 2.4833 475899.76 475899.76 0.00% 534.19 14943.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 25.48 16 35 1516.21 819 2017 1516.44 1398 1666 38628 38628 0.00%
crit 19.14% 6.03 1 14 3026.00 1639 4032 3021.86 2296 3663 18250 18250 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 279.24 210 365 1015.46 2 1261 1015.67 992 1035 283585 283585 0.00%
crit 19.28% 66.69 39 95 2031.10 1 2521 2031.28 1919 2134 135438 135438 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.60
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.80
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 554 6.0% 39.4 7.11sec 4207 2983 Direct 50.0 (50.0) 2781 5564 3316 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.44 50.04 0.00 0.00 1.4106 0.0000 165956.29 165956.29 0.00% 2982.68 2982.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 40.43 25 59 2780.98 1318 3426 2784.20 2544 3037 112509 112509 0.00%
crit 19.20% 9.61 2 25 5563.93 2786 6851 5572.70 4420 6547 53447 53447 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.69
    havoc
    [S]:10.98
  • if_expr:cast_time<havoc_remains
Rain of Fire 965 10.4% 18.4 15.58sec 15646 12603 Periodic 437.9 553 1106 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.45 0.00 0.00 437.94 1.2414 0.0000 288661.88 288661.88 0.00% 12603.12 12603.12
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 353.65 242 516 552.72 507 599 552.71 546 561 195471 195471 0.00%
crit 19.25% 84.28 53 129 1105.58 1013 1198 1105.67 1083 1126 93191 93191 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.50
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.96
Scouring Tithe 330 3.5% 13.4 22.65sec 7377 4389 Direct 18.7 1484 2964 1782 20.1%
Periodic 132.9 413 826 492 19.1% 36.3%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.38 18.72 132.88 132.88 1.6807 2.4561 98727.38 98727.38 0.00% 283.00 4389.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.89% 14.95 7 22 1483.86 1004 1674 1485.33 1359 1674 22188 22188 0.00%
crit 20.11% 3.76 0 13 2964.16 2009 3348 2905.19 0 3348 11143 11143 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.87% 107.46 73 143 413.18 123 419 413.17 410 416 44399 44399 0.00%
crit 19.13% 25.43 12 49 825.86 246 837 825.81 795 837 20997 20997 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.68
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.78
Soul Fire 482 5.2% 5.5 49.45sec 26074 7498 Direct 7.4 16295 32800 19551 19.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 7.40 0.00 0.00 3.4775 0.0000 144510.19 144510.19 0.00% 7498.06 7498.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.37% 5.94 2 10 16295.28 8607 21176 16358.14 11805 19346 96907 96907 0.00%
crit 19.63% 1.45 0 5 32799.67 17216 42337 26552.40 0 42294 47603 47603 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.72
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.92
  • if_expr:cast_time<havoc_remains
Summon Infernal 80 0.9% 2.0 180.44sec 11828 10232 Direct 6.0 3348 6696 3950 17.8%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23655.86 23655.86 0.00% 10231.77 10231.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.24% 4.93 2 6 3348.13 3348 3348 3348.13 3348 3348 16522 16522 0.00%
crit 17.76% 1.07 0 4 6696.27 6696 6696 4507.10 0 6696 7134 7134 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3512 / 712
Immolation 3248 7.0% 39.0 5.49sec 4997 0 Direct 117.0 1395 2790 1666 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194886.68 194886.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 94.30 82 107 1395.06 1395 1395 1395.06 1395 1395 131556 131556 0.00%
crit 19.40% 22.70 10 35 2790.11 2790 2790 2790.11 2790 2790 63330 63330 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 264 0.6% 41.0 5.25sec 386 269 Direct 41.0 326 651 386 18.5%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15823.09 22601.70 29.99% 268.63 268.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.45% 33.40 24 40 325.55 326 326 325.55 326 326 10872 15530 29.99%
crit 18.55% 7.60 1 17 651.10 651 651 651.10 651 651 4951 7072 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.5% 93.2 3.21sec 1654 1136 Direct 92.5 1395 2790 1666 19.5%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 154142.98 154142.98 0.00% 1135.80 1135.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 74.50 55 95 1395.06 1395 1395 1395.06 1395 1395 103937 103937 0.00%
crit 19.45% 17.99 7 34 2790.11 2790 2790 2790.11 2790 2790 50206 50206 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
pet - bron 61 / 6
melee 61 0.1% 9.0 2.88sec 205 157 Direct 9.0 172 343 205 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.3020 0.0000 1841.16 2629.91 29.99% 157.12 157.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 7.28 2 9 171.70 172 172 171.70 172 172 1249 1785 29.99%
crit 19.15% 1.72 0 7 343.40 343 343 299.16 0 343 592 845 26.13%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Havoc 9.6 32.23sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.64
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
pet - bron
Anima Cannon 4.0 8.00sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:4.00
Vitalizing Bolt (goliath_support) 7.0 4.00sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:7.00
Smash 3.0 8.17sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 2.1710 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:4.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 8.0sec 8.0sec 4.5sec 55.05% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.7s
  • trigger_min/max:1.9s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:55.05%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 2.0 135.7 189.3sec 2.2sec 148.8sec 99.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:176.5s / 203.9s
  • trigger_min/max:0.0s / 8.0s
  • trigger_pct:100.00%
  • duration_min/max:43.7s / 200.9s

Stack Uptimes

  • brons_call_to_action_1:1.34%
  • brons_call_to_action_2:1.57%
  • brons_call_to_action_3:1.24%
  • brons_call_to_action_4:1.66%
  • brons_call_to_action_5:1.60%
  • brons_call_to_action_6:1.69%
  • brons_call_to_action_7:1.56%
  • brons_call_to_action_8:1.30%
  • brons_call_to_action_9:1.13%
  • brons_call_to_action_10:1.46%
  • brons_call_to_action_11:0.90%
  • brons_call_to_action_12:1.59%
  • brons_call_to_action_13:1.41%
  • brons_call_to_action_14:1.04%
  • brons_call_to_action_15:1.34%
  • brons_call_to_action_16:1.27%
  • brons_call_to_action_17:1.22%
  • brons_call_to_action_18:1.38%
  • brons_call_to_action_19:1.51%
  • brons_call_to_action_20:1.38%
  • brons_call_to_action_21:1.31%
  • brons_call_to_action_22:1.35%
  • brons_call_to_action_23:1.37%
  • brons_call_to_action_24:1.44%
  • brons_call_to_action_25:1.52%
  • brons_call_to_action_26:1.62%
  • brons_call_to_action_27:1.62%
  • brons_call_to_action_28:1.59%
  • brons_call_to_action_29:1.54%
  • brons_call_to_action_30:1.46%
  • brons_call_to_action_31:1.43%
  • brons_call_to_action_32:1.39%
  • brons_call_to_action_33:1.40%
  • brons_call_to_action_34:1.32%
  • brons_call_to_action_35:1.29%
  • brons_call_to_action_36:1.30%
  • brons_call_to_action_37:1.25%
  • brons_call_to_action_38:1.20%
  • brons_call_to_action_39:1.10%
  • brons_call_to_action_40:1.20%
  • brons_call_to_action_41:1.16%
  • brons_call_to_action_42:1.07%
  • brons_call_to_action_43:1.06%
  • brons_call_to_action_44:1.08%
  • brons_call_to_action_45:1.09%
  • brons_call_to_action_46:1.03%
  • brons_call_to_action_47:1.08%
  • brons_call_to_action_48:1.11%
  • brons_call_to_action_49:1.10%
  • brons_call_to_action_50:1.13%
  • brons_call_to_action_51:1.17%
  • brons_call_to_action_52:1.16%
  • brons_call_to_action_53:1.18%
  • brons_call_to_action_54:1.11%
  • brons_call_to_action_55:1.08%
  • brons_call_to_action_56:1.04%
  • brons_call_to_action_57:0.91%
  • brons_call_to_action_58:0.85%
  • brons_call_to_action_59:0.81%
  • brons_call_to_action_60:0.83%
  • brons_call_to_action_61:0.85%
  • brons_call_to_action_62:0.87%
  • brons_call_to_action_63:0.86%
  • brons_call_to_action_64:0.85%
  • brons_call_to_action_65:0.87%
  • brons_call_to_action_66:0.86%
  • brons_call_to_action_67:0.85%
  • brons_call_to_action_68:0.85%
  • brons_call_to_action_69:0.90%
  • brons_call_to_action_70:0.96%
  • brons_call_to_action_71:1.03%
  • brons_call_to_action_72:0.97%
  • brons_call_to_action_73:0.88%
  • brons_call_to_action_74:0.80%
  • brons_call_to_action_75:0.71%
  • brons_call_to_action_76:0.69%
  • brons_call_to_action_77:0.69%
  • brons_call_to_action_78:0.70%
  • brons_call_to_action_79:0.71%
  • brons_call_to_action_80:0.71%
  • brons_call_to_action_81:0.78%
  • brons_call_to_action_82:0.73%
  • brons_call_to_action_83:0.74%
  • brons_call_to_action_84:0.76%
  • brons_call_to_action_85:0.74%
  • brons_call_to_action_86:0.74%
  • brons_call_to_action_87:0.70%
  • brons_call_to_action_88:0.64%
  • brons_call_to_action_89:0.63%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.97% 7.79% 14.21% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
soul_fire Soul Shard 6.55 6.92 7.35% 1.06 0.53 7.07%
immolate Soul Shard 345.97 33.32 35.35% 0.10 1.28 3.69%
incinerate Soul Shard 39.48 10.05 10.66% 0.25 0.03 0.31%
conflagrate Soul Shard 36.80 27.46 29.13% 0.75 0.00 0.00%
mana_regen Mana 659.94 121306.71 100.00% 183.81 28236.60 18.88%
immolate_crits Soul Shard 33.17 3.18 3.38% 0.10 0.13 4.03%
incinerate_crits Soul Shard 9.63 0.96 1.02% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.30 10.92% 0.09 1.70 14.19%
souring_tithe Soul Shard 1.02 2.06 2.19% 2.03 3.02 59.38%
pet - imp
energy_regen Energy 360.76 3557.55 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.70 407.68 28261.1 49106.5 47724.0 50000.0
Soul Shard 4.0 0.31 0.31 6.7 4.4 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
cataclysm Mana 9.7 4847.0 500.0 500.5 48.2
channel_demonfire Mana 11.9 8948.2 750.0 749.5 33.5
chaos_bolt Soul Shard 18.7 37.5 2.0 2.0 11953.7
conflagrate Mana 36.8 18399.3 500.0 499.9 12.9
havoc Mana 9.6 9634.3 1000.0 1000.4 0.0
immolate Mana 25.3 18965.5 750.0 749.8 25.1
incinerate Mana 39.5 39477.6 1000.0 1000.8 4.2
rain_of_fire Soul Shard 18.5 55.4 3.0 3.0 5210.6
scouring_tithe Mana 13.4 13380.6 1000.0 999.8 7.4
soul_fire Mana 6.5 6548.5 1000.0 1181.5 22.1
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.8
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
Kyrian_Forgelite Damage Per Second
Count 520
Mean 9303.54
Minimum 8740.91
Maximum 10050.18
Spread ( max - min ) 1309.27
Range [ ( max - min ) / 2 * 100% ] 7.04%
Standard Deviation 204.9788
5th Percentile 8996.50
95th Percentile 9647.72
( 95th Percentile - 5th Percentile ) 651.23
Mean Distribution
Standard Deviation 8.9889
95.00% Confidence Interval ( 9285.92 - 9321.15 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1865
0.1 Scale Factor Error with Delta=300 359
0.05 Scale Factor Error with Delta=300 1435
0.01 Scale Factor Error with Delta=300 35868
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 520
Mean 5044.21
Minimum 4701.95
Maximum 5508.15
Spread ( max - min ) 806.20
Range [ ( max - min ) / 2 * 100% ] 7.99%
Standard Deviation 126.6387
5th Percentile 4845.70
95th Percentile 5271.35
( 95th Percentile - 5th Percentile ) 425.65
Mean Distribution
Standard Deviation 5.5535
95.00% Confidence Interval ( 5033.32 - 5055.09 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2422
0.1 Scale Factor Error with Delta=300 137
0.05 Scale Factor Error with Delta=300 548
0.01 Scale Factor Error with Delta=300 13691
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 520
Mean 9303.54
Minimum 8740.91
Maximum 10050.18
Spread ( max - min ) 1309.27
Range [ ( max - min ) / 2 * 100% ] 7.04%
Damage
Kyrian_Forgelite Damage
Count 520
Mean 2416060.17
Minimum 1942763.82
Maximum 2935380.77
Spread ( max - min ) 992616.96
Range [ ( max - min ) / 2 * 100% ] 20.54%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.72 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.74 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.50 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.93 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.60 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.64 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.96 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.67 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.68 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.69 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.13 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.92 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.78 scouring_tithe
Q 7.80 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.85 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 10.98 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFEDLFFJKLDJLJADLEHNRSRQPN9FIEJLJLAIKHNRSSQSNEIFLJKLLILA9HNRNRPSNEFFFILJLLLAIHPNRSNQSE9FIJKILJLAHSNRRSQNEKLFIMJLFLDAHNOPRNDELDJFLFFJIKLAHNRSSNRQEFJK9FILJILAHNRSPSNQEFILFJLLILJKAHRONQREJIKLFJLFFI

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.008 cds M summon_infernal Fluffy_Pillow 49754.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.014 aoe H havoc enemy2 49257.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.021 havoc P scouring_tithe Fluffy_Pillow 48760.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.362 havoc R chaos_bolt Fluffy_Pillow 48431.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.370 havoc N conflagrate Fluffy_Pillow 49435.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.378 havoc R chaos_bolt Fluffy_Pillow 49439.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:11.785 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:12.792 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.800 havoc R chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft
0:15.207 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.211 aoe D rain_of_fire Fluffy_Pillow 49958.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.218 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:18.225 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:20.562 aoe D rain_of_fire Fluffy_Pillow 49671.0/50000: 99% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:21.569 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
bloodlust, backdraft
0:22.509 aoe F immolate enemy2 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
bloodlust
0:23.515 aoe F immolate Fluffy_Pillow 48755.5/50000: 98% mana
1.3/5: 26% soul_shard
bloodlust
0:24.523 aoe J conflagrate Fluffy_Pillow 48509.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust
0:25.531 aoe K scouring_tithe Fluffy_Pillow 48513.5/50000: 97% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:26.872 aoe L incinerate Fluffy_Pillow 48184.0/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:27.811 aoe D rain_of_fire Fluffy_Pillow 47653.5/50000: 95% mana
3.6/5: 72% soul_shard
bloodlust
0:28.818 aoe J conflagrate Fluffy_Pillow 48157.0/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:29.823 aoe L incinerate Fluffy_Pillow 48159.5/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:30.765 aoe J conflagrate Fluffy_Pillow 47630.5/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust
0:31.770 default A cataclysm Fluffy_Pillow 47633.0/50000: 95% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:33.109 aoe D rain_of_fire Fluffy_Pillow 47802.5/50000: 96% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:34.116 aoe L incinerate Fluffy_Pillow 48306.0/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:35.057 aoe E channel_demonfire Fluffy_Pillow 47776.5/50000: 96% mana
1.5/5: 30% soul_shard
bloodlust
0:37.305 aoe H havoc enemy2 48150.5/50000: 96% mana
1.8/5: 36% soul_shard
bloodlust
0:38.313 havoc N conflagrate Fluffy_Pillow 47654.5/50000: 95% mana
2.1/5: 42% soul_shard
bloodlust
0:39.320 havoc R chaos_bolt Fluffy_Pillow 47658.0/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:40.729 havoc S incinerate Fluffy_Pillow 48362.5/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust
0:42.070 havoc R chaos_bolt Fluffy_Pillow 48033.0/50000: 96% mana
2.3/5: 46% soul_shard
0:44.680 havoc Q immolate Fluffy_Pillow 49338.0/50000: 99% mana
0.8/5: 16% soul_shard
0:45.986 havoc P scouring_tithe Fluffy_Pillow 49241.0/50000: 98% mana
0.8/5: 16% soul_shard
0:47.725 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
0:49.031 default 9 soul_fire Fluffy_Pillow 49154.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
0:52.508 aoe F immolate enemy3 49002.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
0:53.814 aoe I rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
0:55.121 aoe E channel_demonfire Fluffy_Pillow 49558.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
0:58.047 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
0:59.353 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft
1:00.573 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
1:01.879 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:03.099 default A cataclysm Fluffy_Pillow 48765.5/50000: 98% mana
3.5/5: 70% soul_shard
1:04.848 aoe I rain_of_fire Fluffy_Pillow 49140.0/50000: 98% mana
3.6/5: 72% soul_shard
1:06.153 aoe K scouring_tithe Fluffy_Pillow 49792.5/50000: 100% mana
0.8/5: 16% soul_shard
1:07.893 aoe H havoc enemy2 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
1:09.201 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
1.1/5: 22% soul_shard
1:10.508 havoc R chaos_bolt Fluffy_Pillow 48809.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:12.336 havoc S incinerate Fluffy_Pillow 49723.5/50000: 99% mana
0.5/5: 10% soul_shard
1:14.077 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
1:15.819 havoc Q immolate Fluffy_Pillow 48873.5/50000: 98% mana
1.9/5: 38% soul_shard
1:17.125 havoc S incinerate Fluffy_Pillow 48776.5/50000: 98% mana
1.9/5: 38% soul_shard
1:18.864 havoc N conflagrate Fluffy_Pillow 48646.0/50000: 97% mana
2.6/5: 52% soul_shard
1:20.170 aoe E channel_demonfire Fluffy_Pillow 48799.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
1:23.055 aoe I rain_of_fire Fluffy_Pillow 49491.5/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
1:24.362 aoe F immolate enemy3 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
1:25.671 aoe L incinerate Fluffy_Pillow 49253.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
1:26.889 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
1.7/5: 34% soul_shard
1:28.196 aoe K scouring_tithe Fluffy_Pillow 49016.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
1:29.937 aoe L incinerate Fluffy_Pillow 48886.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:31.155 aoe L incinerate Fluffy_Pillow 48495.5/50000: 97% mana
2.8/5: 56% soul_shard
1:32.898 aoe I rain_of_fire Fluffy_Pillow 48367.0/50000: 97% mana
3.2/5: 64% soul_shard
1:34.205 aoe L incinerate Fluffy_Pillow 49020.5/50000: 98% mana
0.5/5: 10% soul_shard
1:35.943 default A cataclysm Fluffy_Pillow 48889.5/50000: 98% mana
0.8/5: 16% soul_shard
1:37.684 default 9 soul_fire Fluffy_Pillow 49260.0/50000: 99% mana
1.0/5: 20% soul_shard
1:41.162 aoe H havoc enemy2 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
1:42.469 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
2.5/5: 50% soul_shard
1:43.777 havoc R chaos_bolt Fluffy_Pillow 48810.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
1:45.605 havoc N conflagrate Fluffy_Pillow 49724.0/50000: 99% mana
1.9/5: 38% soul_shard
1:46.912 havoc R chaos_bolt Fluffy_Pillow 49877.5/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
1:48.740 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
1:50.479 havoc S incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
1:52.220 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.1/5: 42% soul_shard
1:53.625 aoe E channel_demonfire Fluffy_Pillow 49074.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:56.457 aoe F immolate enemy3 49740.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
1:57.764 aoe F immolate Fluffy_Pillow 49252.5/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
1:59.071 aoe F immolate enemy2 49156.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
2:00.377 aoe I rain_of_fire Fluffy_Pillow 49059.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
2:01.682 aoe L incinerate Fluffy_Pillow 49711.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
2:02.902 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
2:04.208 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
2:05.431 aoe L incinerate Fluffy_Pillow 48767.0/50000: 98% mana
2.4/5: 48% soul_shard
2:07.171 aoe L incinerate Fluffy_Pillow 48637.0/50000: 97% mana
2.8/5: 56% soul_shard
2:08.910 default A cataclysm Fluffy_Pillow 48506.5/50000: 97% mana
3.3/5: 66% soul_shard
2:10.650 aoe I rain_of_fire Fluffy_Pillow 48876.5/50000: 98% mana
3.6/5: 72% soul_shard
2:11.957 aoe H havoc enemy2 49530.0/50000: 99% mana
0.7/5: 14% soul_shard
2:13.263 havoc P scouring_tithe Fluffy_Pillow 49183.0/50000: 98% mana
0.9/5: 18% soul_shard
2:15.004 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:16.311 havoc R chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:18.139 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
2:19.880 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:21.188 havoc Q immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:22.494 havoc S incinerate Fluffy_Pillow 49059.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:23.714 aoe E channel_demonfire Fluffy_Pillow 48669.5/50000: 97% mana
3.1/5: 62% soul_shard
2:26.553 default 9 soul_fire Fluffy_Pillow 49339.0/50000: 99% mana
3.7/5: 74% soul_shard
2:30.031 aoe F immolate enemy3 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
2:31.335 aoe I rain_of_fire Fluffy_Pillow 48904.5/50000: 98% mana
5.0/5: 100% soul_shard
2:32.643 aoe J conflagrate Fluffy_Pillow 49558.5/50000: 99% mana
2.1/5: 42% soul_shard
2:33.949 aoe K scouring_tithe Fluffy_Pillow 49711.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
2:35.689 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
2:36.996 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
2:38.215 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
2:39.521 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:40.742 default A cataclysm Fluffy_Pillow 48765.5/50000: 98% mana
1.5/5: 30% soul_shard
2:42.482 aoe H havoc enemy2 49135.5/50000: 98% mana
1.8/5: 36% soul_shard
2:43.789 havoc S incinerate Fluffy_Pillow 48789.0/50000: 98% mana
1.9/5: 38% soul_shard
2:45.530 havoc N conflagrate Fluffy_Pillow 48659.5/50000: 97% mana
2.5/5: 50% soul_shard
2:46.837 havoc R chaos_bolt Fluffy_Pillow 48813.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
2:48.666 havoc R chaos_bolt Fluffy_Pillow 49727.5/50000: 99% mana
2.0/5: 40% soul_shard
2:51.275 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:53.015 havoc Q immolate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
2:54.323 havoc N conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.1/5: 22% soul_shard
2:55.628 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:58.615 aoe K scouring_tithe Fluffy_Pillow 49802.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
3:00.354 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
3:01.574 aoe F immolate enemy3 48611.5/50000: 97% mana
3.0/5: 60% soul_shard
3:02.880 aoe I rain_of_fire Fluffy_Pillow 48514.5/50000: 97% mana
3.3/5: 66% soul_shard
brons_call_to_action
3:04.187 cds M summon_infernal Fluffy_Pillow 49168.0/50000: 98% mana
0.3/5: 6% soul_shard
brons_call_to_action
3:05.495 aoe J conflagrate Fluffy_Pillow 48822.0/50000: 98% mana
0.8/5: 16% soul_shard
brons_call_to_action(2)
3:06.802 aoe L incinerate Fluffy_Pillow 48975.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, brons_call_to_action(3)
3:08.021 aoe F immolate enemy2 48585.0/50000: 97% mana
2.4/5: 48% soul_shard
brons_call_to_action(4)
3:09.328 aoe L incinerate Fluffy_Pillow 48488.5/50000: 97% mana
2.7/5: 54% soul_shard
brons_call_to_action(5)
3:11.068 aoe D rain_of_fire Fluffy_Pillow 48358.5/50000: 97% mana
3.5/5: 70% soul_shard
brons_call_to_action(6)
3:12.376 default A cataclysm Fluffy_Pillow 49012.5/50000: 98% mana
0.9/5: 18% soul_shard
brons_call_to_action(6)
3:14.219 aoe H havoc enemy2 49434.0/50000: 99% mana
1.6/5: 32% soul_shard
brons_call_to_action(7)
3:15.526 havoc N conflagrate Fluffy_Pillow 49087.5/50000: 98% mana
2.0/5: 40% soul_shard
brons_call_to_action(7)
3:16.833 havoc O soul_fire Fluffy_Pillow 49241.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, brons_call_to_action(8)
3:20.310 havoc P scouring_tithe Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, brons_call_to_action(9)
3:22.049 havoc R chaos_bolt Fluffy_Pillow 48871.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, brons_call_to_action(10)
3:23.875 havoc N conflagrate Fluffy_Pillow 49784.5/50000: 100% mana
3.0/5: 60% soul_shard
brons_call_to_action(11)
3:25.181 aoe D rain_of_fire Fluffy_Pillow 49937.5/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, brons_call_to_action(11)
3:26.488 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft, brons_call_to_action(12)
3:29.430 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, brons_call_to_action(13)
3:30.650 aoe D rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
brons_call_to_action(14)
3:31.956 aoe J conflagrate Fluffy_Pillow 49655.5/50000: 99% mana
0.8/5: 16% soul_shard
brons_call_to_action(14)
3:33.262 aoe F immolate enemy3 49808.5/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, brons_call_to_action(15)
3:34.569 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, brons_call_to_action(16)
3:35.788 aoe F immolate enemy2 48862.0/50000: 98% mana
2.4/5: 48% soul_shard
brons_call_to_action(17)
3:37.094 aoe F immolate Fluffy_Pillow 48765.0/50000: 98% mana
2.6/5: 52% soul_shard
brons_call_to_action(18)
3:38.401 aoe J conflagrate Fluffy_Pillow 48668.5/50000: 97% mana
2.7/5: 54% soul_shard
brons_call_to_action(19)
3:39.708 aoe I rain_of_fire Fluffy_Pillow 48822.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, brons_call_to_action(19)
3:41.013 aoe K scouring_tithe Fluffy_Pillow 49474.5/50000: 99% mana
0.5/5: 10% soul_shard
backdraft, brons_call_to_action(20)
3:42.754 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
backdraft, brons_call_to_action(21)
3:43.974 default A cataclysm Fluffy_Pillow 48612.5/50000: 97% mana
1.1/5: 22% soul_shard
brons_call_to_action(22)
3:45.953 aoe H havoc enemy2 49102.0/50000: 98% mana
1.5/5: 30% soul_shard
brons_call_to_action(23)
3:47.260 havoc N conflagrate Fluffy_Pillow 48755.5/50000: 98% mana
1.7/5: 34% soul_shard
brons_call_to_action(23)
3:48.566 havoc R chaos_bolt Fluffy_Pillow 48908.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, brons_call_to_action(24)
3:50.394 havoc S incinerate Fluffy_Pillow 49822.5/50000: 100% mana
1.0/5: 20% soul_shard
brons_call_to_action(25)
3:52.135 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
brons_call_to_action(26)
3:53.876 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
2.3/5: 46% soul_shard
brons_call_to_action(27)
3:55.181 havoc R chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, brons_call_to_action(27)
3:57.009 havoc Q immolate Fluffy_Pillow 49939.5/50000: 100% mana
1.7/5: 34% soul_shard
brons_call_to_action(28)
3:58.316 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
1.8/5: 36% soul_shard
brons_call_to_action(29)
4:01.105 aoe F immolate enemy2 49897.0/50000: 100% mana
2.2/5: 44% soul_shard
brons_call_to_action(29)
4:02.411 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
brons_call_to_action(30)
4:03.717 aoe K scouring_tithe Fluffy_Pillow 49405.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, brons_call_to_action(30)
4:05.458 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, brons_call_to_action(31)
4:08.937 aoe F immolate enemy3 49003.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft, brons_call_to_action(32)
4:10.244 aoe I rain_of_fire Fluffy_Pillow 48906.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, brons_call_to_action(33)
4:11.551 aoe L incinerate Fluffy_Pillow 49560.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, brons_call_to_action(33)
4:12.771 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
brons_call_to_action(34)
4:14.078 aoe I rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, brons_call_to_action(34)
4:15.385 aoe L incinerate Fluffy_Pillow 49809.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, brons_call_to_action(35)
4:16.605 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
brons_call_to_action(36)
4:18.345 aoe H havoc enemy2 49372.5/50000: 99% mana
1.0/5: 20% soul_shard
brons_call_to_action(37)
4:19.651 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
1.1/5: 22% soul_shard
brons_call_to_action(37)
4:20.957 havoc R chaos_bolt Fluffy_Pillow 49178.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, brons_call_to_action(38)
4:22.786 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
brons_call_to_action(39)
4:24.527 havoc P scouring_tithe Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
brons_call_to_action(40)
4:26.267 havoc S incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.4/5: 28% soul_shard
brons_call_to_action(41)
4:28.007 havoc N conflagrate Fluffy_Pillow 48742.5/50000: 97% mana
1.9/5: 38% soul_shard
brons_call_to_action(42)
4:29.315 havoc Q immolate Fluffy_Pillow 48896.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, brons_call_to_action(42)
4:30.621 aoe E channel_demonfire Fluffy_Pillow 48799.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, brons_call_to_action(43)
4:33.474 aoe F immolate enemy2 49476.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft, brons_call_to_action(43)
4:34.782 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.8/5: 76% soul_shard
backdraft, brons_call_to_action(44)
4:36.088 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft, brons_call_to_action(44)
4:37.308 aoe F immolate enemy3 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
brons_call_to_action(45)
4:38.614 aoe J conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.5/5: 30% soul_shard
brons_call_to_action(46)
4:39.920 aoe L incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, brons_call_to_action(46)
4:41.139 aoe L incinerate Fluffy_Pillow 48668.0/50000: 97% mana
2.5/5: 50% soul_shard
brons_call_to_action(47)
4:42.879 aoe I rain_of_fire Fluffy_Pillow 48538.0/50000: 97% mana
3.1/5: 62% soul_shard
brons_call_to_action(48)
4:44.185 aoe L incinerate Fluffy_Pillow 49191.0/50000: 98% mana
0.3/5: 6% soul_shard
brons_call_to_action(48)
4:45.924 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.7/5: 14% soul_shard
brons_call_to_action(49)
4:47.231 aoe K scouring_tithe Fluffy_Pillow 49155.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft, brons_call_to_action(49)
4:48.971 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, brons_call_to_action(50)
4:50.711 aoe H havoc enemy2 49372.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, brons_call_to_action(51)
4:52.016 havoc R chaos_bolt Fluffy_Pillow 49024.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, brons_call_to_action(51)
4:53.841 havoc O soul_fire Fluffy_Pillow 49937.0/50000: 100% mana
0.4/5: 8% soul_shard
brons_call_to_action(52)
4:57.406 havoc N conflagrate Fluffy_Pillow 49001.0/50000: 98% mana
2.8/5: 56% soul_shard
brons_call_to_action(53)
4:58.711 havoc Q immolate Fluffy_Pillow 49153.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft, brons_call_to_action(53)
5:00.019 havoc R chaos_bolt Fluffy_Pillow 49057.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft, brons_call_to_action(54)
5:01.845 aoe E channel_demonfire Fluffy_Pillow 49970.5/50000: 100% mana
2.4/5: 48% soul_shard
brons_call_to_action(55)
5:04.645 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
brons_call_to_action(55)
5:05.952 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft, brons_call_to_action(56)
5:07.258 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, brons_call_to_action(57)
5:08.998 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
backdraft, brons_call_to_action(58)
5:10.218 aoe F immolate enemy3 48612.0/50000: 97% mana
1.1/5: 22% soul_shard
brons_call_to_action(59)
5:11.526 aoe J conflagrate Fluffy_Pillow 48516.0/50000: 97% mana
1.3/5: 26% soul_shard
brons_call_to_action(60)
5:12.833 aoe L incinerate Fluffy_Pillow 48669.5/50000: 97% mana
1.9/5: 38% soul_shard
backdraft, brons_call_to_action(60)
5:14.051 aoe F immolate Fluffy_Pillow 48278.5/50000: 97% mana
2.4/5: 48% soul_shard
brons_call_to_action(61)
5:15.357 aoe F immolate enemy2 48181.5/50000: 96% mana
2.4/5: 48% soul_shard
brons_call_to_action(62)
5:16.663 aoe I rain_of_fire Fluffy_Pillow 48084.5/50000: 96% mana
3.0/5: 60% soul_shard
brons_call_to_action(63)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Forgelite"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=333950/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_Pelagos : 9624 dps, 5235 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9624.5 9624.5 17.6 / 0.183% 797.9 / 8.3% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.6 404.8 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 9624
Cataclysm 785 8.2% 9.7 32.30sec 24254 14274 Direct 29.1 6764 13534 8084 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.70 29.09 0.00 0.00 1.6992 0.0000 235218.90 235218.90 0.00% 14273.86 14273.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 23.42 13 33 6764.48 6141 8264 6762.72 6421 7130 158427 158427 0.00%
crit 19.50% 5.67 1 12 13533.87 12283 16514 13535.22 12500 15080 76792 76792 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.76
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1035) 0.0% (10.8%) 11.9 26.09sec 26111 9636

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.86 0.00 177.32 0.00 2.7097 0.1645 0.00 0.00 0.00% 9636.38 9636.38

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.86
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1035 10.8% 0.0 0.00sec 0 0 Direct 532.0 488 975 582 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 531.96 0.00 0.00 0.0000 0.0000 309771.06 309771.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 429.14 318 561 488.21 263 1111 488.54 465 529 209507 209507 0.00%
crit 19.33% 102.82 66 146 975.40 525 2222 976.12 855 1131 100264 100264 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1183 (1573) 12.3% (16.3%) 18.8 15.45sec 24978 12556 Direct 37.5 (74.0) 0 9448 9448 100.0% (60.2%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.84 37.47 0.00 0.00 1.9893 0.0000 353952.91 353952.91 0.00% 12556.00 12556.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.47 26 50 9447.61 5872 13934 9449.36 8997 9909 353953 353953 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.93
  • if_expr:cast_time<havoc_remains
    Internal Combustion 390 4.1% 36.6 15.49sec 3193 0 Direct 36.6 2674 5355 3194 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.56 36.56 0.00 0.00 0.0000 0.0000 116733.67 116733.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 29.46 18 43 2673.70 1 4229 2678.35 2405 3071 78764 78764 0.00%
crit 19.42% 7.10 1 15 5354.97 7 8455 5365.21 3482 7680 37970 37970 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 822 8.5% 36.8 7.95sec 6682 5348 Direct 54.8 3763 7510 4488 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.81 54.79 0.00 0.00 1.2494 0.0000 245951.53 245951.53 0.00% 5347.82 5347.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 44.17 29 58 3762.61 2047 5739 3762.97 3462 4106 166166 166166 0.00%
crit 19.39% 10.62 3 23 7510.07 4097 11478 7522.72 5888 9972 79786 79786 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.80
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.00
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1649 17.2% 25.4 11.35sec 19490 15479 Direct 31.6 1592 3178 1901 19.5%
Periodic 346.6 1050 2100 1253 19.3% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.35 31.62 346.56 346.56 1.2592 2.4821 494144.49 494144.49 0.00% 553.90 15478.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 25.46 15 36 1591.94 819 2296 1592.47 1446 1745 40522 40522 0.00%
crit 19.46% 6.15 0 12 3178.01 1643 4591 3174.99 0 4231 19565 19565 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 279.73 214 348 1050.14 0 1435 1050.27 1027 1080 293746 293746 0.00%
crit 19.28% 66.83 37 99 2099.76 4 2870 2099.84 1978 2204 140312 140312 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.64
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.82
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 573 6.0% 39.4 7.16sec 4365 3098 Direct 50.0 (50.0) 2880 5770 3434 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.36 50.02 0.00 0.00 1.4091 0.0000 171798.56 171798.56 0.00% 3097.65 3097.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 40.42 24 59 2879.66 1316 3900 2881.42 2531 3129 116391 116391 0.00%
crit 19.19% 9.60 2 21 5770.19 2675 7799 5772.39 4534 7050 55407 55407 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.56
    havoc
    [S]:11.02
  • if_expr:cast_time<havoc_remains
Rain of Fire 1000 10.4% 18.4 15.50sec 16206 13054 Periodic 437.7 572 1146 683 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.45 0.00 0.00 437.70 1.2415 0.0000 298994.09 298994.09 0.00% 13054.23 13054.23
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.70% 353.21 250 472 572.48 507 682 572.45 559 588 202190 202190 0.00%
crit 19.30% 84.49 51 125 1145.78 1013 1364 1145.61 1109 1194 96804 96804 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.44
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.00
Scouring Tithe 332 3.5% 13.4 22.48sec 7392 4398 Direct 18.8 1481 2979 1777 19.8%
Periodic 133.8 413 826 493 19.2% 36.6%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.44 18.84 133.75 133.75 1.6810 2.4568 99354.97 99354.97 0.00% 282.91 4397.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.25% 15.12 9 23 1480.65 1004 1674 1481.23 1339 1607 22387 22387 0.00%
crit 19.75% 3.72 0 12 2978.62 2009 3348 2873.61 0 3348 11071 11071 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.76% 108.01 75 146 413.17 123 419 413.16 411 415 44628 44628 0.00%
crit 19.24% 25.74 11 41 826.39 246 837 826.36 794 837 21269 21269 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.67
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.83
Soul Fire 485 5.0% 5.5 49.45sec 26229 7543 Direct 7.4 16520 33178 19666 18.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 7.40 0.00 0.00 3.4775 0.0000 145270.71 145270.71 0.00% 7542.61 7542.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.35% 6.02 1 11 16519.64 8600 24094 16583.03 13595 20472 99418 99418 0.00%
crit 18.65% 1.38 0 6 33178.10 17237 48160 26460.02 0 47292 45853 45853 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.72
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.92
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.70sec 11953 10340 Direct 6.0 3348 6696 3986 19.0%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1564 0.0000 23906.97 23906.97 0.00% 10340.39 10340.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.99% 4.86 1 6 3348.13 3348 3348 3348.13 3348 3348 16271 16271 0.00%
crit 19.01% 1.14 0 5 6696.27 6696 6696 4893.43 0 6696 7636 7636 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3825 / 775
Immolation 3558 7.4% 39.0 5.50sec 5474 0 Direct 117.0 1528 3066 1825 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213479.56 213479.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 94.46 81 105 1528.27 1395 2023 1528.16 1495 1561 144352 144352 0.00%
crit 19.26% 22.54 12 36 3066.15 2790 4046 3067.65 2827 3359 69127 69127 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 267 0.6% 41.0 5.26sec 390 272 Direct 41.0 326 651 390 19.9%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16005.90 22862.83 29.99% 271.73 271.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.08% 32.83 24 40 325.55 326 326 325.55 326 326 10689 15269 29.99%
crit 19.92% 8.17 1 17 651.10 651 651 651.10 651 651 5317 7594 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.4% 93.2 3.21sec 1655 1137 Direct 92.5 1395 2790 1668 19.5%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 154266.39 154266.39 0.00% 1136.68 1136.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 74.42 54 97 1395.06 1395 1395 1395.06 1395 1395 103814 103814 0.00%
crit 19.55% 18.08 7 30 2790.11 2790 2790 2790.11 2790 2790 50453 50453 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
Kyrian_Pelagos
Havoc 9.6 32.09sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 0.00 0.00 0.00 1.2443 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.65
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 8.0sec 8.0sec 4.5sec 55.00% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.5s
  • trigger_min/max:1.9s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:55.00%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combat Meditation 4.8 0.0 67.5sec 67.5sec 18.5sec 29.50% 0.00% 27.8 (27.8) 4.5

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:60.5s / 82.8s
  • trigger_min/max:60.5s / 82.8s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 19.0s

Stack Uptimes

  • combat_meditation_1:29.50%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.9s
  • trigger_min/max:180.0s / 185.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.9s
  • trigger_min/max:180.0s / 185.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.96% 7.41% 14.00% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
soul_fire Soul Shard 6.55 6.92 7.33% 1.06 0.54 7.28%
immolate Soul Shard 346.56 33.39 35.39% 0.10 1.27 3.66%
incinerate Soul Shard 39.38 10.04 10.64% 0.25 0.03 0.30%
conflagrate Soul Shard 36.80 27.39 29.03% 0.74 0.00 0.00%
mana_regen Mana 658.80 121322.11 100.00% 184.16 28230.56 18.88%
immolate_crits Soul Shard 33.43 3.23 3.42% 0.10 0.12 3.45%
incinerate_crits Soul Shard 9.60 0.96 1.02% 0.10 0.00 0.17%
infernal Soul Shard 120.00 10.30 10.92% 0.09 1.70 14.15%
souring_tithe Soul Shard 1.01 2.12 2.25% 2.11 2.91 57.80%
pet - imp
energy_regen Energy 360.75 3557.58 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.78 407.62 28249.9 49148.4 47864.5 50000.0
Soul Shard 4.0 0.31 0.31 6.5 4.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
cataclysm Mana 9.7 4853.5 500.0 500.5 48.5
channel_demonfire Mana 11.9 8897.9 750.0 750.0 34.8
chaos_bolt Soul Shard 18.8 37.6 2.0 2.0 12501.9
conflagrate Mana 36.8 18398.3 500.0 499.8 13.4
havoc Mana 9.6 9647.4 1000.0 1000.1 0.0
immolate Mana 25.4 19013.1 750.0 749.9 26.0
incinerate Mana 39.4 39384.3 1000.0 1000.6 4.4
rain_of_fire Soul Shard 18.4 55.3 3.0 3.0 5403.6
scouring_tithe Mana 13.4 13432.8 1000.0 999.4 7.4
soul_fire Mana 6.6 6550.4 1000.0 1182.7 22.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.4

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
Kyrian_Pelagos Damage Per Second
Count 520
Mean 9624.49
Minimum 9073.52
Maximum 10240.16
Spread ( max - min ) 1166.63
Range [ ( max - min ) / 2 * 100% ] 6.06%
Standard Deviation 205.0274
5th Percentile 9322.43
95th Percentile 9991.08
( 95th Percentile - 5th Percentile ) 668.65
Mean Distribution
Standard Deviation 8.9910
95.00% Confidence Interval ( 9606.87 - 9642.11 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1744
0.1 Scale Factor Error with Delta=300 359
0.05 Scale Factor Error with Delta=300 1436
0.01 Scale Factor Error with Delta=300 35885
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 520
Mean 5234.96
Minimum 4883.19
Maximum 5639.79
Spread ( max - min ) 756.60
Range [ ( max - min ) / 2 * 100% ] 7.23%
Standard Deviation 126.4274
5th Percentile 5042.31
95th Percentile 5453.22
( 95th Percentile - 5th Percentile ) 410.91
Mean Distribution
Standard Deviation 5.5442
95.00% Confidence Interval ( 5224.10 - 5245.83 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2241
0.1 Scale Factor Error with Delta=300 137
0.05 Scale Factor Error with Delta=300 546
0.01 Scale Factor Error with Delta=300 13645
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 520
Mean 9624.49
Minimum 9073.52
Maximum 10240.16
Spread ( max - min ) 1166.63
Range [ ( max - min ) / 2 * 100% ] 6.06%
Damage
Kyrian_Pelagos Damage
Count 520
Mean 2495097.87
Minimum 2016783.99
Maximum 3030095.95
Spread ( max - min ) 1013311.96
Range [ ( max - min ) / 2 * 100% ] 20.31%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.72 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.76 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.44 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.86 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.64 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.65 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.00 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.80 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.67 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.56 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.00 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.92 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.83 scouring_tithe
Q 7.82 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.93 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.02 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFELDFFJKLDJLJADLEHNRSRONFFIKELJLIAJLHNRSPQREJFLJLLFI9AHNPRNRSQEFJIFLLJKLLIAHNRSSNQS9EIFJKILJLLAHNRRSSNPFEFFMDJLLD9AHPRNRNQDELIJFLJKFLIJAHSRSNQRP9EFIJFLJLLAHNPRRNQELIJLFLLKJIL9AEHNRNRPQLJILFL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.985 cds M summon_infernal Fluffy_Pillow 49742.5/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.992 aoe H havoc enemy2 49246.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:06.000 havoc P scouring_tithe Fluffy_Pillow 48750.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.342 havoc R chaos_bolt Fluffy_Pillow 48421.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust, combat_meditation
0:09.351 havoc N conflagrate Fluffy_Pillow 49425.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, combat_meditation
0:10.356 havoc R chaos_bolt Fluffy_Pillow 49428.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, combat_meditation
0:11.760 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, combat_meditation
0:12.765 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, combat_meditation
0:13.771 havoc R chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft, combat_meditation
0:15.177 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, combat_meditation
0:16.183 aoe D rain_of_fire Fluffy_Pillow 49958.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, combat_meditation
0:17.191 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, combat_meditation
0:18.197 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft, combat_meditation
0:20.671 aoe L incinerate Fluffy_Pillow 49739.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, backdraft, combat_meditation
0:21.610 aoe D rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.4/5: 68% soul_shard
bloodlust, combat_meditation
0:22.616 aoe F immolate enemy2 49505.0/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust, combat_meditation
0:23.623 aoe F immolate Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
bloodlust, combat_meditation
0:24.629 aoe J conflagrate Fluffy_Pillow 49005.5/50000: 98% mana
1.7/5: 34% soul_shard
bloodlust, combat_meditation
0:25.638 aoe K scouring_tithe Fluffy_Pillow 49010.0/50000: 98% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, combat_meditation
0:26.980 aoe L incinerate Fluffy_Pillow 48681.0/50000: 97% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:27.919 aoe D rain_of_fire Fluffy_Pillow 48150.5/50000: 96% mana
3.7/5: 74% soul_shard
bloodlust
0:28.925 aoe J conflagrate Fluffy_Pillow 48653.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:29.931 aoe L incinerate Fluffy_Pillow 48656.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:30.872 aoe J conflagrate Fluffy_Pillow 48127.0/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust
0:31.878 default A cataclysm Fluffy_Pillow 48130.0/50000: 96% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:33.219 aoe D rain_of_fire Fluffy_Pillow 48300.5/50000: 97% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:34.226 aoe L incinerate Fluffy_Pillow 48804.0/50000: 98% mana
1.2/5: 24% soul_shard
bloodlust, backdraft
0:35.165 aoe E channel_demonfire Fluffy_Pillow 48273.5/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust
0:37.465 aoe H havoc enemy2 48673.5/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust
0:38.471 havoc N conflagrate Fluffy_Pillow 48176.5/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust
0:39.477 havoc R chaos_bolt Fluffy_Pillow 48179.5/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:40.882 havoc S incinerate Fluffy_Pillow 48882.0/50000: 98% mana
1.3/5: 26% soul_shard
bloodlust
0:42.223 havoc R chaos_bolt Fluffy_Pillow 48552.5/50000: 97% mana
2.1/5: 42% soul_shard
0:44.833 havoc O soul_fire Fluffy_Pillow 49857.5/50000: 100% mana
0.4/5: 8% soul_shard
0:48.476 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.5/5: 50% soul_shard
0:49.781 aoe F immolate Fluffy_Pillow 49154.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
0:51.088 aoe F immolate enemy3 49057.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
0:52.396 aoe I rain_of_fire Fluffy_Pillow 48961.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
0:53.703 aoe K scouring_tithe Fluffy_Pillow 49615.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
0:55.442 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
0:58.327 aoe L incinerate Fluffy_Pillow 49694.0/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
0:59.546 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
1:00.852 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:02.072 aoe I rain_of_fire Fluffy_Pillow 48765.0/50000: 98% mana
3.0/5: 60% soul_shard
1:03.377 default A cataclysm Fluffy_Pillow 49417.5/50000: 99% mana
0.3/5: 6% soul_shard
1:05.117 aoe J conflagrate Fluffy_Pillow 49502.0/50000: 99% mana
0.3/5: 6% soul_shard
1:06.424 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
1:07.643 aoe H havoc enemy2 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
1:08.949 havoc N conflagrate Fluffy_Pillow 48655.0/50000: 97% mana
1.6/5: 32% soul_shard
1:10.357 havoc R chaos_bolt Fluffy_Pillow 48859.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:12.184 havoc S incinerate Fluffy_Pillow 49772.5/50000: 100% mana
1.0/5: 20% soul_shard
1:13.924 havoc P scouring_tithe Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
1:15.663 havoc Q immolate Fluffy_Pillow 48871.5/50000: 98% mana
1.7/5: 34% soul_shard
combat_meditation
1:16.971 havoc R chaos_bolt Fluffy_Pillow 48775.5/50000: 98% mana
2.0/5: 40% soul_shard
combat_meditation
1:19.581 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
combat_meditation
1:22.415 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
combat_meditation
1:23.721 aoe F immolate enemy3 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft, combat_meditation
1:25.029 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, combat_meditation
1:26.246 aoe J conflagrate Fluffy_Pillow 48861.5/50000: 98% mana
1.8/5: 36% soul_shard
combat_meditation
1:27.651 aoe L incinerate Fluffy_Pillow 49064.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, combat_meditation
1:28.870 aoe L incinerate Fluffy_Pillow 48673.5/50000: 97% mana
2.8/5: 56% soul_shard
combat_meditation
1:30.609 aoe F immolate enemy2 48543.0/50000: 97% mana
3.2/5: 64% soul_shard
combat_meditation
1:31.917 aoe I rain_of_fire Fluffy_Pillow 48447.0/50000: 97% mana
3.5/5: 70% soul_shard
combat_meditation
1:33.223 default 9 soul_fire Fluffy_Pillow 49100.0/50000: 98% mana
0.5/5: 10% soul_shard
combat_meditation
1:36.952 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
2.0/5: 40% soul_shard
1:38.693 aoe H havoc enemy2 49373.5/50000: 99% mana
2.1/5: 42% soul_shard
1:39.999 havoc N conflagrate Fluffy_Pillow 49026.5/50000: 98% mana
2.3/5: 46% soul_shard
1:41.307 havoc P scouring_tithe Fluffy_Pillow 49180.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
1:43.045 havoc R chaos_bolt Fluffy_Pillow 49001.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
1:44.872 havoc N conflagrate Fluffy_Pillow 49914.5/50000: 100% mana
2.1/5: 42% soul_shard
1:46.178 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
1:48.005 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
1:49.745 havoc Q immolate Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
1:51.050 aoe E channel_demonfire Fluffy_Pillow 48904.5/50000: 98% mana
2.2/5: 44% soul_shard
1:53.965 aoe F immolate enemy2 49612.0/50000: 99% mana
2.5/5: 50% soul_shard
1:55.269 aoe J conflagrate Fluffy_Pillow 49251.0/50000: 99% mana
2.7/5: 54% soul_shard
1:56.576 aoe I rain_of_fire Fluffy_Pillow 49404.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
1:57.882 aoe F immolate enemy3 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:59.190 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
2:00.410 aoe L incinerate Fluffy_Pillow 48863.0/50000: 98% mana
1.1/5: 22% soul_shard
2:02.152 aoe J conflagrate Fluffy_Pillow 48734.0/50000: 97% mana
1.5/5: 30% soul_shard
2:03.458 aoe K scouring_tithe Fluffy_Pillow 48887.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:05.199 aoe L incinerate Fluffy_Pillow 48757.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:06.418 aoe L incinerate Fluffy_Pillow 48367.0/50000: 97% mana
2.9/5: 58% soul_shard
2:08.159 aoe I rain_of_fire Fluffy_Pillow 48237.5/50000: 96% mana
3.4/5: 68% soul_shard
2:09.468 default A cataclysm Fluffy_Pillow 48892.0/50000: 98% mana
0.6/5: 12% soul_shard
2:11.208 aoe H havoc enemy2 49262.0/50000: 99% mana
1.0/5: 20% soul_shard
2:12.515 havoc N conflagrate Fluffy_Pillow 48915.5/50000: 98% mana
1.0/5: 20% soul_shard
2:13.824 havoc R chaos_bolt Fluffy_Pillow 49070.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:15.651 havoc S incinerate Fluffy_Pillow 49983.5/50000: 100% mana
0.4/5: 8% soul_shard
2:17.391 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
2:19.132 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
2:20.440 havoc Q immolate Fluffy_Pillow 49026.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:21.748 havoc S incinerate Fluffy_Pillow 48930.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
2:22.968 default 9 soul_fire Fluffy_Pillow 48540.5/50000: 97% mana
3.8/5: 76% soul_shard
2:26.445 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
2:29.296 aoe I rain_of_fire Fluffy_Pillow 49677.5/50000: 99% mana
5.0/5: 100% soul_shard
2:30.602 aoe F immolate enemy3 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
2:31.909 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.3/5: 46% soul_shard
2:33.215 aoe K scouring_tithe Fluffy_Pillow 49405.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
2:34.957 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, combat_meditation
2:36.264 aoe L incinerate Fluffy_Pillow 49656.5/50000: 99% mana
0.2/5: 4% soul_shard
backdraft, combat_meditation
2:37.483 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
combat_meditation
2:38.789 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, combat_meditation
2:40.008 aoe L incinerate Fluffy_Pillow 48764.5/50000: 98% mana
1.8/5: 36% soul_shard
combat_meditation
2:41.750 default A cataclysm Fluffy_Pillow 48635.5/50000: 97% mana
2.1/5: 42% soul_shard
combat_meditation
2:43.491 aoe H havoc enemy2 49006.0/50000: 98% mana
2.3/5: 46% soul_shard
combat_meditation
2:44.796 havoc N conflagrate Fluffy_Pillow 48658.5/50000: 97% mana
2.5/5: 50% soul_shard
combat_meditation
2:46.103 havoc R chaos_bolt Fluffy_Pillow 48812.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, combat_meditation
2:47.929 havoc R chaos_bolt Fluffy_Pillow 49725.0/50000: 99% mana
2.0/5: 40% soul_shard
combat_meditation
2:50.539 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
combat_meditation
2:52.280 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
combat_meditation
2:54.020 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.5/5: 30% soul_shard
2:55.326 havoc P scouring_tithe Fluffy_Pillow 49025.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:57.068 aoe F immolate Fluffy_Pillow 48896.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:58.376 aoe E channel_demonfire Fluffy_Pillow 48800.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
3:01.252 aoe F immolate enemy2 49488.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
3:02.559 aoe F immolate enemy3 49252.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
3:03.865 cds M summon_infernal Fluffy_Pillow 49155.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
3:05.293 aoe D rain_of_fire Fluffy_Pillow 48869.5/50000: 98% mana
3.9/5: 78% soul_shard
3:06.598 aoe J conflagrate Fluffy_Pillow 49522.0/50000: 99% mana
1.3/5: 26% soul_shard
3:07.905 aoe L incinerate Fluffy_Pillow 49675.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:09.126 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.8/5: 56% soul_shard
3:10.866 aoe D rain_of_fire Fluffy_Pillow 48873.0/50000: 98% mana
3.6/5: 72% soul_shard
3:12.173 default 9 soul_fire Fluffy_Pillow 49526.5/50000: 99% mana
1.0/5: 20% soul_shard
3:15.651 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
3:17.391 aoe H havoc enemy2 49372.5/50000: 99% mana
3.6/5: 72% soul_shard
3:18.696 havoc P scouring_tithe Fluffy_Pillow 49025.0/50000: 98% mana
4.1/5: 82% soul_shard
3:20.436 havoc R chaos_bolt Fluffy_Pillow 48895.0/50000: 98% mana
4.5/5: 90% soul_shard
3:23.046 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:24.352 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:26.178 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.484 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
3:28.791 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:30.097 aoe E channel_demonfire Fluffy_Pillow 49905.5/50000: 100% mana
2.1/5: 42% soul_shard
backdraft
3:32.886 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
3:34.105 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.7/5: 74% soul_shard
3:35.412 aoe J conflagrate Fluffy_Pillow 49655.5/50000: 99% mana
0.7/5: 14% soul_shard
3:36.718 aoe F immolate enemy3 49808.5/50000: 100% mana
1.5/5: 30% soul_shard
backdraft
3:38.023 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
3:39.241 aoe J conflagrate Fluffy_Pillow 48860.5/50000: 98% mana
2.0/5: 40% soul_shard
3:40.548 aoe K scouring_tithe Fluffy_Pillow 49014.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:42.290 aoe F immolate enemy2 48885.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, combat_meditation
3:43.597 aoe L incinerate Fluffy_Pillow 48788.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, combat_meditation
3:44.816 aoe I rain_of_fire Fluffy_Pillow 48398.0/50000: 97% mana
3.4/5: 68% soul_shard
combat_meditation
3:46.121 aoe J conflagrate Fluffy_Pillow 49050.5/50000: 98% mana
0.5/5: 10% soul_shard
combat_meditation
3:47.427 default A cataclysm Fluffy_Pillow 49203.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, combat_meditation
3:49.170 aoe H havoc enemy2 49503.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, combat_meditation
3:50.477 havoc S incinerate Fluffy_Pillow 49157.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, combat_meditation
3:51.695 havoc R chaos_bolt Fluffy_Pillow 48766.0/50000: 98% mana
2.1/5: 42% soul_shard
combat_meditation
3:54.303 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
combat_meditation
3:56.044 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
combat_meditation
3:57.350 havoc Q immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, combat_meditation
3:58.655 havoc R chaos_bolt Fluffy_Pillow 49058.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, combat_meditation
4:00.481 havoc P scouring_tithe Fluffy_Pillow 49971.0/50000: 100% mana
1.2/5: 24% soul_shard
combat_meditation
4:02.222 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:05.700 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
4:08.496 aoe F immolate enemy3 49650.5/50000: 99% mana
3.3/5: 66% soul_shard
4:09.800 aoe I rain_of_fire Fluffy_Pillow 49251.0/50000: 99% mana
3.3/5: 66% soul_shard
4:11.107 aoe J conflagrate Fluffy_Pillow 49904.5/50000: 100% mana
0.6/5: 12% soul_shard
4:12.412 aoe F immolate enemy2 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
4:13.715 aoe L incinerate Fluffy_Pillow 49250.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
4:14.934 aoe J conflagrate Fluffy_Pillow 48860.0/50000: 98% mana
1.6/5: 32% soul_shard
4:16.241 aoe L incinerate Fluffy_Pillow 49013.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:17.462 aoe L incinerate Fluffy_Pillow 48624.0/50000: 97% mana
2.6/5: 52% soul_shard
4:19.203 default A cataclysm Fluffy_Pillow 48494.5/50000: 97% mana
3.1/5: 62% soul_shard
4:20.944 aoe H havoc enemy2 48865.0/50000: 98% mana
3.4/5: 68% soul_shard
4:22.251 havoc N conflagrate Fluffy_Pillow 48518.5/50000: 97% mana
3.4/5: 68% soul_shard
4:23.559 havoc P scouring_tithe Fluffy_Pillow 48672.5/50000: 97% mana
4.8/5: 96% soul_shard
backdraft
4:25.300 havoc R chaos_bolt Fluffy_Pillow 48543.0/50000: 97% mana
4.8/5: 96% soul_shard
backdraft
4:27.127 havoc R chaos_bolt Fluffy_Pillow 49456.5/50000: 99% mana
3.0/5: 60% soul_shard
4:29.735 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
4:31.044 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
4:32.350 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
4:35.158 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
4:36.379 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.3/5: 66% soul_shard
4:37.686 aoe J conflagrate Fluffy_Pillow 49656.5/50000: 99% mana
0.4/5: 8% soul_shard
4:38.994 aoe L incinerate Fluffy_Pillow 49810.5/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
4:40.214 aoe F immolate enemy3 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:41.522 aoe L incinerate Fluffy_Pillow 48906.5/50000: 98% mana
1.6/5: 32% soul_shard
4:43.262 aoe L incinerate Fluffy_Pillow 48776.5/50000: 98% mana
1.9/5: 38% soul_shard
4:45.002 aoe K scouring_tithe Fluffy_Pillow 48646.5/50000: 97% mana
2.6/5: 52% soul_shard
4:46.743 aoe J conflagrate Fluffy_Pillow 48517.0/50000: 97% mana
2.8/5: 56% soul_shard
combat_meditation
4:48.048 aoe I rain_of_fire Fluffy_Pillow 48669.5/50000: 97% mana
3.4/5: 68% soul_shard
backdraft, combat_meditation
4:49.355 aoe L incinerate Fluffy_Pillow 49323.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, combat_meditation
4:50.577 default 9 soul_fire Fluffy_Pillow 48934.0/50000: 98% mana
1.1/5: 22% soul_shard
combat_meditation
4:54.172 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
combat_meditation
4:55.913 aoe E channel_demonfire Fluffy_Pillow 49372.5/50000: 99% mana
2.7/5: 54% soul_shard
combat_meditation
4:58.821 aoe H havoc enemy2 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
combat_meditation
5:00.129 havoc N conflagrate Fluffy_Pillow 49654.0/50000: 99% mana
3.1/5: 62% soul_shard
combat_meditation
5:01.434 havoc R chaos_bolt Fluffy_Pillow 49806.5/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, combat_meditation
5:03.261 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
combat_meditation
5:04.567 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft, combat_meditation
5:06.395 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
5:08.137 havoc Q immolate Fluffy_Pillow 49003.0/50000: 98% mana
2.1/5: 42% soul_shard
5:09.443 aoe L incinerate Fluffy_Pillow 48906.0/50000: 98% mana
2.3/5: 46% soul_shard
5:11.184 aoe J conflagrate Fluffy_Pillow 48776.5/50000: 98% mana
2.6/5: 52% soul_shard
5:12.528 aoe I rain_of_fire Fluffy_Pillow 48948.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
5:13.834 aoe L incinerate Fluffy_Pillow 49601.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
5:15.052 aoe F immolate enemy3 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
5:16.358 aoe L incinerate Fluffy_Pillow 48904.5/50000: 98% mana
1.2/5: 24% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Pelagos"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=328266/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necrolord_Emeni : 9858 dps, 5432 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9858.0 9858.0 18.5 / 0.187% 796.0 / 8.1% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
420.5 417.2 Mana 0.00% 38.0 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 9858
Cataclysm 788 8.0% 9.7 32.46sec 24432 14380 Direct 29.0 6812 13640 8138 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.66 28.98 0.00 0.00 1.6991 0.0000 236004.14 236004.14 0.00% 14379.97 14379.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 23.32 14 33 6811.74 6141 8348 6810.25 6510 7148 158811 158811 0.00%
crit 19.53% 5.66 0 15 13639.53 12283 16696 13631.38 0 16636 77193 77193 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.72
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1043) 0.0% (10.6%) 12.1 25.70sec 25790 9601

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.10 0.00 180.58 0.00 2.6861 0.1630 0.00 0.00 0.00% 9601.28 9601.28

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.10
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1043 10.6% 0.0 0.00sec 0 0 Direct 541.7 483 967 576 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 541.74 0.00 0.00 0.0000 0.0000 312156.87 312156.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 437.95 327 592 483.49 263 1122 483.97 455 515 211812 211812 0.00%
crit 19.16% 103.79 69 148 966.72 525 2245 967.17 804 1153 100345 100345 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1203 (1598) 12.2% (16.2%) 19.1 15.26sec 25010 12429 Direct 38.1 (75.4) 0 9452 9452 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.12 38.08 0.00 0.00 2.0122 0.0000 360001.40 360001.40 0.00% 12429.43 12429.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 38.08 28 50 9452.35 5866 14074 9454.89 9113 9844 360001 360001 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:19.21
  • if_expr:cast_time<havoc_remains
    Internal Combustion 395 4.0% 37.3 15.32sec 3171 0 Direct 37.3 2663 5299 3170 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.29 37.28 0.00 0.00 0.0000 0.0000 118258.17 118258.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 30.11 19 44 2662.97 1 4271 2665.81 2413 2920 80202 80202 0.00%
crit 19.24% 7.17 1 15 5298.79 2 8543 5313.03 2157 7274 38056 38056 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 825 8.4% 36.7 7.96sec 6724 5382 Direct 55.2 3747 7492 4473 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.73 55.20 0.00 0.00 1.2493 0.0000 246941.93 246941.93 0.00% 5381.99 5381.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 44.51 28 58 3747.03 2047 5797 3746.32 3496 3997 166751 166751 0.00%
crit 19.38% 10.70 3 22 7491.89 4095 11590 7495.49 5794 9690 80191 80191 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:18.25
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.47
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (188) 0.0% (1.9%) 6.4 49.38sec 8821 4206

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.39 0.00 0.00 0.00 2.0971 0.0000 0.00 0.00 0.00% 4206.44 4206.44

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:3.02
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    havoc
    [P]:3.43
  • if_expr:cast_time<havoc_remains&soulbind.lead_by_example.enabled
    Decimating Bolt (_tick_t) 188 1.9% 0.0 0.00sec 0 0 Direct 39.0 1209 2424 1444 19.3%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 38.99 0.00 0.00 0.0000 0.0000 56353.68 56353.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 31.45 20 45 1209.48 592 1925 1208.90 1095 1316 38050 38050 0.00%
crit 19.34% 7.54 0 15 2424.34 1185 3850 2419.14 0 3315 18303 18303 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1646 16.7% 25.9 11.22sec 19017 15090 Direct 32.4 1544 3116 1845 19.2%
Periodic 348.5 1042 2083 1243 19.4% 96.3%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.92 32.38 348.46 348.46 1.2602 2.4836 492976.08 492976.08 0.00% 548.92 15090.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 26.16 17 38 1544.06 819 2318 1543.93 1376 1673 40390 40390 0.00%
crit 19.20% 6.22 0 16 3115.98 1639 4635 3105.21 0 4452 19377 19377 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.63% 280.98 218 348 1041.51 0 1449 1041.67 1022 1064 292663 292663 0.00%
crit 19.37% 67.48 42 98 2082.63 8 2899 2083.40 1981 2226 140546 140546 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.14
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.91
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 941 9.6% 43.3 6.37sec 6509 4510 Direct 54.2 (54.2) 4344 8721 5200 19.6% (19.6%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.33 54.22 0.00 0.00 1.4433 0.0000 282011.62 282011.62 0.00% 4509.52 4509.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 43.61 26 62 4344.27 1391 10162 4351.51 3637 5034 189498 189498 0.00%
crit 19.56% 10.61 1 20 8720.52 2783 19961 8738.66 4667 19283 92513 92513 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:32.33
    havoc
    [S]:11.24
  • if_expr:cast_time<havoc_remains
Rain of Fire 987 10.0% 18.5 15.57sec 15952 12848 Periodic 438.8 564 1129 673 19.1% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.50 0.00 0.00 438.80 1.2416 0.0000 295141.65 295141.65 0.00% 12847.89 12847.89
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.85% 354.79 250 477 564.49 507 689 564.43 554 574 200284 200284 0.00%
crit 19.15% 84.01 47 121 1129.16 1013 1378 1129.15 1089 1166 94858 94858 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.44
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.05
Soul Fire 495 5.0% 5.6 49.56sec 26615 7654 Direct 7.9 15898 31924 18878 18.5%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.86 0.00 0.00 3.4775 0.0000 148226.60 148226.60 0.00% 7653.57 7653.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.47% 6.40 3 11 15898.39 8604 21175 15931.17 12650 19476 101684 101684 0.00%
crit 18.53% 1.46 0 5 31924.07 17216 42323 25613.74 0 42323 46543 46543 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.30
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.35
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.63sec 11934 10319 Direct 6.0 3348 6696 3979 18.8%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23868.34 23868.34 0.00% 10319.21 10319.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.19% 4.87 1 6 3348.13 3348 3348 3348.13 3348 3348 16309 16309 0.00%
crit 18.81% 1.13 0 5 6696.27 6696 6696 4790.41 0 6696 7559 7559 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3650 / 740
Immolation 3377 6.9% 39.0 5.50sec 5195 0 Direct 117.0 1450 2904 1731 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 202605.50 202605.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 94.33 84 106 1449.89 1395 1604 1449.87 1423 1464 136764 136764 0.00%
crit 19.38% 22.67 11 33 2904.20 2790 3208 2903.39 2790 2999 65842 65842 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 274 0.6% 41.0 5.25sec 401 279 Direct 41.0 338 675 401 18.6%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16426.89 23464.17 29.99% 278.88 278.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.40% 33.37 26 40 337.84 326 374 337.80 332 343 11274 16104 29.99%
crit 18.60% 7.63 1 15 675.46 651 749 675.03 651 724 5153 7361 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 527 / 527
Firebolt 527 5.3% 93.2 3.21sec 1691 1161 Direct 92.5 1427 2851 1703 19.5%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 157600.07 157600.07 0.00% 1161.27 1161.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 74.50 52 94 1426.65 1395 1604 1426.67 1414 1441 106286 106286 0.00%
crit 19.46% 18.00 6 30 2850.87 2790 3208 2850.92 2790 2969 51314 51314 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
Necrolord_Emeni
Havoc 9.6 32.20sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.64
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 8.0sec 8.0sec 4.2sec 51.16% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 25.5s
  • trigger_min/max:1.9s / 25.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:51.16%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 6.4 3.4 49.3sec 30.2sec 15.1sec 32.08% 0.00% 3.4 (10.2) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 60.6s
  • trigger_min/max:0.0s / 60.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.1s

Stack Uptimes

  • decimating_bolt_1:8.42%
  • decimating_bolt_2:9.24%
  • decimating_bolt_3:14.42%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Lead by Example 6.4 0.0 49.3sec 49.3sec 7.4sec 15.81% 0.00% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:7.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 60.6s
  • trigger_min/max:47.2s / 60.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 7.5s

Stack Uptimes

  • lead_by_example_1:15.81%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.3s
  • trigger_min/max:180.0s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.3s
  • trigger_min/max:180.0s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 8.84% 6.08% 12.07% 0.7s 0.0s 5.5s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
soul_fire Soul Shard 6.58 7.21 7.75% 1.10 0.71 8.95%
immolate Soul Shard 348.43 33.22 35.71% 0.10 1.62 4.66%
incinerate Soul Shard 43.33 10.89 11.71% 0.25 0.01 0.08%
conflagrate Soul Shard 36.72 27.59 29.66% 0.75 0.00 0.00%
mana_regen Mana 683.97 125027.26 100.00% 182.80 24530.27 16.40%
immolate_crits Soul Shard 33.95 3.23 3.48% 0.10 0.16 4.77%
incinerate_crits Soul Shard 10.60 1.06 1.14% 0.10 0.00 0.16%
infernal Soul Shard 120.00 9.83 10.56% 0.08 2.17 18.12%
pet - imp
energy_regen Energy 360.75 3557.55 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 417.18 420.53 24533.5 48997.5 46758.5 50000.0
Soul Shard 4.0 0.31 0.31 4.7 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
cataclysm Mana 9.7 4834.9 500.0 500.5 48.8
channel_demonfire Mana 12.1 9078.4 750.0 750.0 34.4
chaos_bolt Soul Shard 19.1 38.2 2.0 2.0 12504.7
conflagrate Mana 36.7 18360.1 500.0 499.9 13.4
decimating_bolt Mana 6.4 12757.5 2000.0 1997.0 4.4
havoc Mana 9.6 9638.1 1000.0 1000.8 0.0
immolate Mana 25.9 19444.0 750.0 750.1 25.4
incinerate Mana 43.3 43328.4 1000.0 1000.0 6.5
rain_of_fire Soul Shard 18.5 55.4 3.0 3.0 5322.7
soul_fire Mana 6.6 6580.2 1000.0 1181.5 22.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 42.3

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
Necrolord_Emeni Damage Per Second
Count 520
Mean 9858.02
Minimum 9346.75
Maximum 10537.15
Spread ( max - min ) 1190.40
Range [ ( max - min ) / 2 * 100% ] 6.04%
Standard Deviation 214.8568
5th Percentile 9549.30
95th Percentile 10227.44
( 95th Percentile - 5th Percentile ) 678.14
Mean Distribution
Standard Deviation 9.4221
95.00% Confidence Interval ( 9839.56 - 9876.49 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1825
0.1 Scale Factor Error with Delta=300 395
0.05 Scale Factor Error with Delta=300 1577
0.01 Scale Factor Error with Delta=300 39408
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 520
Mean 5432.02
Minimum 5131.73
Maximum 5897.78
Spread ( max - min ) 766.04
Range [ ( max - min ) / 2 * 100% ] 7.05%
Standard Deviation 133.1186
5th Percentile 5212.71
95th Percentile 5661.11
( 95th Percentile - 5th Percentile ) 448.41
Mean Distribution
Standard Deviation 5.8376
95.00% Confidence Interval ( 5420.58 - 5443.46 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2308
0.1 Scale Factor Error with Delta=300 152
0.05 Scale Factor Error with Delta=300 606
0.01 Scale Factor Error with Delta=300 15128
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 520
Mean 9858.02
Minimum 9346.75
Maximum 10537.15
Spread ( max - min ) 1190.40
Range [ ( max - min ) / 2 * 100% ] 6.04%
Damage
Necrolord_Emeni Damage
Count 520
Mean 2571940.48
Minimum 2073702.94
Maximum 3095957.64
Spread ( max - min ) 1022254.70
Range [ ( max - min ) / 2 * 100% ] 19.87%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.30 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.72 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.44 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.10 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.14 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.64 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.05 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 3.02 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 18.25 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 32.33 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.47 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.35 soul_fire,if=cast_time<havoc_remains
P 3.43 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
Q 7.91 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 19.21 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.24 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFELDFFKLKDLKLADLEHNRSRONFFIJEKLKAILLHNRSRQSNEFILKFLL9AHNPRNRQEKILLFLKLFFILAHNRSSNRQ9EFFIJKLKLAHNRRSRQEFKLFMFDKLKD9AEHPRNRNQDLLFIEKLKLLAHRNRQSSN9EFIFJKILKAHSRSNRQEKLLFIKLLFFL9AEHPRNRNQILK

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.738 aoe E channel_demonfire Fluffy_Pillow 49369.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.068 cds M summon_infernal Fluffy_Pillow 49784.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust
0:05.075 aoe H havoc enemy2 49287.5/50000: 99% mana
4.6/5: 92% soul_shard
bloodlust
0:06.082 havoc P decimating_bolt Fluffy_Pillow 48791.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.755 havoc R chaos_bolt Fluffy_Pillow 47627.5/50000: 95% mana
5.0/5: 100% soul_shard
bloodlust, lead_by_example
0:09.763 havoc N conflagrate Fluffy_Pillow 48631.5/50000: 97% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3), lead_by_example
0:10.768 havoc R chaos_bolt Fluffy_Pillow 48634.0/50000: 97% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:12.175 havoc N conflagrate Fluffy_Pillow 49337.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3), lead_by_example
0:13.182 havoc Q immolate Fluffy_Pillow 49341.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:14.189 havoc R chaos_bolt Fluffy_Pillow 49094.5/50000: 98% mana
4.7/5: 94% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:15.595 havoc N conflagrate Fluffy_Pillow 49797.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3)
0:16.604 aoe D rain_of_fire Fluffy_Pillow 49802.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:17.613 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:18.621 aoe E channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:20.760 aoe L incinerate Fluffy_Pillow 49572.5/50000: 99% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:21.699 aoe D rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, decimating_bolt(2)
0:22.704 aoe F immolate enemy2 49504.5/50000: 99% mana
0.8/5: 16% soul_shard
bloodlust, decimating_bolt(2)
0:23.713 aoe F immolate Fluffy_Pillow 49253.5/50000: 99% mana
1.1/5: 22% soul_shard
bloodlust, decimating_bolt(2)
0:24.720 aoe K conflagrate Fluffy_Pillow 49007.0/50000: 98% mana
1.6/5: 32% soul_shard
bloodlust, decimating_bolt(2)
0:25.726 aoe L incinerate Fluffy_Pillow 49010.0/50000: 98% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:26.666 aoe K conflagrate Fluffy_Pillow 48480.0/50000: 97% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt
0:27.672 aoe D rain_of_fire Fluffy_Pillow 48483.0/50000: 97% mana
3.7/5: 74% soul_shard
bloodlust, backdraft, decimating_bolt
0:28.681 aoe L incinerate Fluffy_Pillow 48987.5/50000: 98% mana
1.2/5: 24% soul_shard
bloodlust, backdraft, decimating_bolt
0:29.621 aoe K conflagrate Fluffy_Pillow 48457.5/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust
0:30.728 aoe L incinerate Fluffy_Pillow 48511.0/50000: 97% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:31.668 default A cataclysm Fluffy_Pillow 47981.0/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust
0:33.078 aoe D rain_of_fire Fluffy_Pillow 48186.0/50000: 96% mana
3.6/5: 72% soul_shard
bloodlust
0:34.083 aoe L incinerate Fluffy_Pillow 48688.5/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:35.424 aoe E channel_demonfire Fluffy_Pillow 48359.0/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust
0:37.688 aoe H havoc enemy2 48741.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust
0:38.693 havoc N conflagrate Fluffy_Pillow 48243.5/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust
0:39.700 havoc R chaos_bolt Fluffy_Pillow 48247.0/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:41.107 havoc S incinerate Fluffy_Pillow 48950.5/50000: 98% mana
1.4/5: 28% soul_shard
0:42.846 havoc R chaos_bolt Fluffy_Pillow 48820.0/50000: 98% mana
2.1/5: 42% soul_shard
0:45.456 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
0:48.933 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.9/5: 58% soul_shard
0:50.238 aoe F immolate Fluffy_Pillow 49154.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
0:51.545 aoe F immolate enemy3 49058.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
0:52.851 aoe I rain_of_fire Fluffy_Pillow 48961.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
0:54.157 aoe J decimating_bolt Fluffy_Pillow 49614.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
0:56.334 aoe E channel_demonfire Fluffy_Pillow 48003.0/50000: 96% mana
1.7/5: 34% soul_shard
backdraft, lead_by_example
0:59.182 aoe K conflagrate Fluffy_Pillow 48677.0/50000: 97% mana
2.0/5: 40% soul_shard
decimating_bolt(3), lead_by_example
1:00.488 aoe L incinerate Fluffy_Pillow 48830.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt(3), lead_by_example
1:01.708 aoe K conflagrate Fluffy_Pillow 48440.0/50000: 97% mana
3.0/5: 60% soul_shard
decimating_bolt(2), lead_by_example
1:03.016 default A cataclysm Fluffy_Pillow 48594.0/50000: 97% mana
3.6/5: 72% soul_shard
backdraft, decimating_bolt(2), lead_by_example
1:04.812 aoe I rain_of_fire Fluffy_Pillow 48992.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft, decimating_bolt(2)
1:06.118 aoe L incinerate Fluffy_Pillow 49645.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, decimating_bolt(2)
1:07.338 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
decimating_bolt
1:09.079 aoe H havoc enemy2 48873.0/50000: 98% mana
2.2/5: 44% soul_shard
1:10.385 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
2.2/5: 44% soul_shard
1:11.691 havoc R chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
3.5/5: 70% soul_shard
backdraft
1:13.521 havoc S incinerate Fluffy_Pillow 49594.0/50000: 99% mana
1.6/5: 32% soul_shard
1:15.261 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
1:17.870 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:19.175 havoc S incinerate Fluffy_Pillow 49251.5/50000: 99% mana
0.6/5: 12% soul_shard
1:20.915 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
1:22.223 aoe E channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:25.108 aoe F immolate enemy3 49848.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
1:26.415 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:27.722 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
1:28.942 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
1:30.247 aoe F immolate enemy2 49155.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
1:31.552 aoe L incinerate Fluffy_Pillow 49057.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
1:32.771 aoe L incinerate Fluffy_Pillow 48667.0/50000: 97% mana
1.8/5: 36% soul_shard
1:34.513 default 9 soul_fire Fluffy_Pillow 48538.0/50000: 97% mana
2.1/5: 42% soul_shard
1:37.991 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.6/5: 72% soul_shard
1:39.731 aoe H havoc enemy2 49372.5/50000: 99% mana
3.7/5: 74% soul_shard
1:41.036 havoc N conflagrate Fluffy_Pillow 49025.0/50000: 98% mana
3.8/5: 76% soul_shard
1:42.343 havoc P decimating_bolt Fluffy_Pillow 49178.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
1:44.519 havoc R chaos_bolt Fluffy_Pillow 48002.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, lead_by_example
1:46.346 havoc N conflagrate Fluffy_Pillow 48916.0/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
1:47.651 havoc R chaos_bolt Fluffy_Pillow 49068.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft, decimating_bolt(3), lead_by_example
1:49.479 havoc Q immolate Fluffy_Pillow 49982.5/50000: 100% mana
2.3/5: 46% soul_shard
decimating_bolt(3), lead_by_example
1:50.784 aoe E channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
2.6/5: 52% soul_shard
decimating_bolt(3), lead_by_example
1:53.656 aoe K conflagrate Fluffy_Pillow 49937.5/50000: 100% mana
2.9/5: 58% soul_shard
decimating_bolt(3)
1:54.964 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft, decimating_bolt(3)
1:56.272 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, decimating_bolt(3)
1:57.489 aoe L incinerate Fluffy_Pillow 49001.0/50000: 98% mana
1.0/5: 20% soul_shard
decimating_bolt(2)
1:59.228 aoe F immolate enemy3 48870.5/50000: 98% mana
1.4/5: 28% soul_shard
decimating_bolt
2:00.533 aoe L incinerate Fluffy_Pillow 48773.0/50000: 98% mana
1.6/5: 32% soul_shard
decimating_bolt
2:02.273 aoe K conflagrate Fluffy_Pillow 48643.0/50000: 97% mana
1.9/5: 38% soul_shard
2:03.581 aoe L incinerate Fluffy_Pillow 48797.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:04.800 aoe F immolate enemy2 48406.5/50000: 97% mana
2.9/5: 58% soul_shard
2:06.106 aoe F immolate Fluffy_Pillow 48309.5/50000: 97% mana
3.1/5: 62% soul_shard
2:07.411 aoe I rain_of_fire Fluffy_Pillow 48212.0/50000: 96% mana
3.2/5: 64% soul_shard
2:08.719 aoe L incinerate Fluffy_Pillow 48866.0/50000: 98% mana
0.5/5: 10% soul_shard
2:10.461 default A cataclysm Fluffy_Pillow 48737.0/50000: 97% mana
0.9/5: 18% soul_shard
2:12.202 aoe H havoc enemy2 49107.5/50000: 98% mana
1.2/5: 24% soul_shard
2:13.508 havoc N conflagrate Fluffy_Pillow 48760.5/50000: 98% mana
1.4/5: 28% soul_shard
2:14.816 havoc R chaos_bolt Fluffy_Pillow 48914.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:16.645 havoc S incinerate Fluffy_Pillow 49829.0/50000: 100% mana
1.0/5: 20% soul_shard
2:18.385 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
2:20.125 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.2/5: 44% soul_shard
2:21.431 havoc R chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
2:23.258 havoc Q immolate Fluffy_Pillow 49938.5/50000: 100% mana
1.5/5: 30% soul_shard
2:24.565 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
1.8/5: 36% soul_shard
2:28.042 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.1/5: 62% soul_shard
2:30.812 aoe F immolate enemy2 49637.0/50000: 99% mana
3.3/5: 66% soul_shard
2:32.120 aoe F immolate enemy3 49253.0/50000: 99% mana
3.6/5: 72% soul_shard
2:33.425 aoe I rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.6/5: 72% soul_shard
2:34.730 aoe J decimating_bolt Fluffy_Pillow 49808.0/50000: 100% mana
0.9/5: 18% soul_shard
2:36.906 aoe K conflagrate Fluffy_Pillow 48002.5/50000: 96% mana
1.0/5: 20% soul_shard
lead_by_example
2:38.213 aoe L incinerate Fluffy_Pillow 48156.0/50000: 96% mana
1.8/5: 36% soul_shard
backdraft, lead_by_example
2:39.431 aoe K conflagrate Fluffy_Pillow 47765.0/50000: 96% mana
2.1/5: 42% soul_shard
decimating_bolt(2), lead_by_example
2:40.738 aoe L incinerate Fluffy_Pillow 47918.5/50000: 96% mana
2.8/5: 56% soul_shard
backdraft, decimating_bolt(2), lead_by_example
2:41.959 default A cataclysm Fluffy_Pillow 47529.0/50000: 95% mana
3.1/5: 62% soul_shard
decimating_bolt, lead_by_example
2:43.938 aoe H havoc enemy2 48018.5/50000: 96% mana
3.4/5: 68% soul_shard
decimating_bolt, lead_by_example
2:45.245 havoc N conflagrate Fluffy_Pillow 47672.0/50000: 95% mana
3.7/5: 74% soul_shard
decimating_bolt
2:46.552 havoc R chaos_bolt Fluffy_Pillow 47825.5/50000: 96% mana
4.7/5: 94% soul_shard
backdraft, decimating_bolt
2:48.379 havoc R chaos_bolt Fluffy_Pillow 48739.0/50000: 97% mana
3.0/5: 60% soul_shard
decimating_bolt
2:50.989 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
decimating_bolt
2:52.728 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.2/5: 44% soul_shard
2:55.337 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:56.642 aoe E channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
0.6/5: 12% soul_shard
2:59.494 aoe F immolate enemy2 49927.5/50000: 100% mana
0.9/5: 18% soul_shard
3:00.802 aoe K conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
3:02.109 aoe L incinerate Fluffy_Pillow 49406.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
3:03.329 aoe F immolate enemy3 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
3:04.636 cds M summon_infernal Fluffy_Pillow 48906.0/50000: 98% mana
2.2/5: 44% soul_shard
3:05.944 aoe F immolate Fluffy_Pillow 48560.0/50000: 97% mana
2.7/5: 54% soul_shard
3:07.250 aoe D rain_of_fire Fluffy_Pillow 48463.0/50000: 97% mana
3.1/5: 62% soul_shard
3:08.556 aoe K conflagrate Fluffy_Pillow 49116.0/50000: 98% mana
0.5/5: 10% soul_shard
3:09.862 aoe L incinerate Fluffy_Pillow 49269.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
3:11.082 aoe K conflagrate Fluffy_Pillow 48879.0/50000: 98% mana
2.1/5: 42% soul_shard
3:12.388 aoe D rain_of_fire Fluffy_Pillow 49032.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
3:13.694 default 9 soul_fire Fluffy_Pillow 49685.0/50000: 99% mana
0.7/5: 14% soul_shard
backdraft
3:17.170 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:18.911 aoe E channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
3:21.842 aoe H havoc enemy2 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
3:23.151 havoc P decimating_bolt Fluffy_Pillow 49654.5/50000: 99% mana
4.7/5: 94% soul_shard
3:25.326 havoc R chaos_bolt Fluffy_Pillow 48002.0/50000: 96% mana
5.0/5: 100% soul_shard
lead_by_example
3:27.936 havoc N conflagrate Fluffy_Pillow 49307.0/50000: 99% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
3:29.245 havoc R chaos_bolt Fluffy_Pillow 49461.5/50000: 99% mana
4.5/5: 90% soul_shard
backdraft, decimating_bolt(3), lead_by_example
3:31.073 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
decimating_bolt(3), lead_by_example
3:32.378 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, decimating_bolt(3), lead_by_example
3:33.684 aoe D rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.8/5: 96% soul_shard
backdraft, decimating_bolt(3)
3:34.991 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
2.1/5: 42% soul_shard
backdraft, decimating_bolt(3)
3:36.210 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
decimating_bolt(2)
3:37.949 aoe F immolate enemy3 48871.5/50000: 98% mana
2.8/5: 56% soul_shard
decimating_bolt
3:39.256 aoe I rain_of_fire Fluffy_Pillow 48775.0/50000: 98% mana
3.3/5: 66% soul_shard
decimating_bolt
3:40.561 aoe E channel_demonfire Fluffy_Pillow 49427.5/50000: 99% mana
0.3/5: 6% soul_shard
decimating_bolt
3:43.522 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
decimating_bolt
3:44.830 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
backdraft, decimating_bolt
3:46.050 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
3:47.358 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:48.577 aoe L incinerate Fluffy_Pillow 48766.0/50000: 98% mana
2.6/5: 52% soul_shard
3:50.317 default A cataclysm Fluffy_Pillow 48636.0/50000: 97% mana
3.1/5: 62% soul_shard
3:52.057 aoe H havoc enemy2 49006.0/50000: 98% mana
3.5/5: 70% soul_shard
3:53.365 havoc R chaos_bolt Fluffy_Pillow 48660.0/50000: 97% mana
3.5/5: 70% soul_shard
3:55.975 havoc N conflagrate Fluffy_Pillow 49965.0/50000: 100% mana
1.8/5: 36% soul_shard
3:57.281 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
3:59.109 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
4:00.417 havoc S incinerate Fluffy_Pillow 49253.0/50000: 99% mana
1.4/5: 28% soul_shard
4:02.158 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
4:03.898 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
2.6/5: 52% soul_shard
4:05.205 default 9 soul_fire Fluffy_Pillow 49026.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
4:08.682 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
4:11.578 aoe F immolate enemy3 49700.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:12.883 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:14.189 aoe F immolate enemy2 49904.5/50000: 100% mana
2.2/5: 44% soul_shard
4:15.495 aoe J decimating_bolt Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
4:17.670 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
2.5/5: 50% soul_shard
lead_by_example
4:18.976 aoe I rain_of_fire Fluffy_Pillow 48155.0/50000: 96% mana
3.3/5: 66% soul_shard
backdraft, lead_by_example
4:20.282 aoe L incinerate Fluffy_Pillow 48808.0/50000: 98% mana
0.3/5: 6% soul_shard
backdraft, decimating_bolt(3), lead_by_example
4:21.501 aoe K conflagrate Fluffy_Pillow 48417.5/50000: 97% mana
0.8/5: 16% soul_shard
decimating_bolt(2), lead_by_example
4:22.806 default A cataclysm Fluffy_Pillow 48570.0/50000: 97% mana
1.3/5: 26% soul_shard
backdraft, decimating_bolt(2), lead_by_example
4:24.546 aoe H havoc enemy2 48940.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt(2), lead_by_example
4:25.852 havoc S incinerate Fluffy_Pillow 48593.0/50000: 97% mana
1.8/5: 36% soul_shard
backdraft, decimating_bolt(2)
4:27.073 havoc R chaos_bolt Fluffy_Pillow 48203.5/50000: 96% mana
2.4/5: 48% soul_shard
decimating_bolt
4:29.684 havoc S incinerate Fluffy_Pillow 49509.0/50000: 99% mana
0.8/5: 16% soul_shard
decimating_bolt
4:31.424 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
4:32.730 havoc R chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:34.556 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
4:35.863 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
4:38.718 aoe K conflagrate Fluffy_Pillow 49930.0/50000: 100% mana
1.2/5: 24% soul_shard
4:40.026 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
4:41.245 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
4:42.986 aoe F immolate enemy3 48872.5/50000: 98% mana
2.7/5: 54% soul_shard
4:44.293 aoe I rain_of_fire Fluffy_Pillow 48776.0/50000: 98% mana
3.1/5: 62% soul_shard
4:45.599 aoe K conflagrate Fluffy_Pillow 49429.0/50000: 99% mana
0.1/5: 2% soul_shard
4:47.116 aoe L incinerate Fluffy_Pillow 49687.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
4:48.335 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
4:50.075 aoe F immolate enemy2 48872.0/50000: 98% mana
1.6/5: 32% soul_shard
4:51.380 aoe F immolate Fluffy_Pillow 48774.5/50000: 98% mana
1.6/5: 32% soul_shard
4:52.686 aoe L incinerate Fluffy_Pillow 48677.5/50000: 97% mana
2.1/5: 42% soul_shard
4:54.424 default 9 soul_fire Fluffy_Pillow 48546.5/50000: 97% mana
2.3/5: 46% soul_shard
4:57.902 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.9/5: 78% soul_shard
4:59.643 aoe E channel_demonfire Fluffy_Pillow 49373.0/50000: 99% mana
3.9/5: 78% soul_shard
5:02.423 aoe H havoc enemy2 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
5:03.730 havoc P decimating_bolt Fluffy_Pillow 49653.5/50000: 99% mana
4.6/5: 92% soul_shard
5:05.906 havoc R chaos_bolt Fluffy_Pillow 48002.5/50000: 96% mana
5.0/5: 100% soul_shard
lead_by_example
5:08.516 havoc N conflagrate Fluffy_Pillow 49307.5/50000: 99% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
5:09.824 havoc R chaos_bolt Fluffy_Pillow 49461.5/50000: 99% mana
4.0/5: 80% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:11.652 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
decimating_bolt(3), lead_by_example
5:12.958 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:14.265 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft, decimating_bolt(3)
5:15.572 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, decimating_bolt(3)
5:16.791 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
decimating_bolt(2)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necrolord_Emeni"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=342156/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necrolord_Marileth : 9687 dps, 5390 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9686.5 9686.5 18.4 / 0.190% 822.3 / 8.5% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
406.1 402.4 Mana 0.00% 37.7 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Marileth 9687
Cataclysm 773 8.0% 9.6 32.49sec 24013 14134 Direct 28.9 6699 13393 8008 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 28.94 0.00 0.00 1.6990 0.0000 231628.70 231628.70 0.00% 14134.04 14134.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 23.29 14 32 6699.35 6142 7261 6698.63 6480 6934 156049 156049 0.00%
crit 19.50% 5.64 1 16 13393.47 12284 14520 13394.76 12376 14415 75580 75580 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.72
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1015) 0.0% (10.5%) 12.1 25.69sec 25207 9357

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.06 0.00 180.18 0.00 2.6939 0.1634 0.00 0.00 0.00% 9357.18 9357.18

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.07
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1015 10.5% 0.0 0.00sec 0 0 Direct 540.5 472 943 562 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 540.52 0.00 0.00 0.0000 0.0000 304033.62 304033.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 436.42 293 577 471.85 263 976 472.13 447 496 205928 205928 0.00%
crit 19.26% 104.11 62 148 942.68 525 1952 943.15 799 1083 98106 98106 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1350 (1814) 13.9% (18.7%) 22.4 13.18sec 24162 12214 Direct 44.7 (88.9) 0 9037 9037 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.44 44.66 0.00 0.00 1.9782 0.0000 403593.73 403593.73 0.00% 12214.07 12214.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.66 34 56 9036.65 5864 12241 9037.05 8862 9218 403594 403594 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.54
  • if_expr:cast_time<havoc_remains
    Internal Combustion 464 4.8% 44.2 13.13sec 3137 0 Direct 44.2 2629 5274 3138 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.20 44.20 0.00 0.00 0.0000 0.0000 138650.04 138650.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 35.71 24 50 2629.37 1 3715 2631.05 2469 2861 93888 93888 0.00%
crit 19.21% 8.49 2 17 5274.34 26 7428 5279.99 3941 6450 44762 44762 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 821 8.5% 37.0 7.96sec 6649 5321 Direct 57.0 3604 7234 4314 19.5%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.95 56.97 0.00 0.00 1.2497 0.0000 245689.24 245689.24 0.00% 5320.60 5320.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 45.84 31 61 3603.71 2047 5042 3604.63 3370 3808 165227 165227 0.00%
crit 19.53% 11.13 3 27 7234.27 4095 10084 7225.64 5793 8537 80463 80463 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:16.98
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.95
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (100) 0.0% (1.0%) 5.0 61.45sec 5955 2869

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.03 0.00 0.00 0.00 2.0760 0.0000 0.00 0.00 0.00% 2868.73 2868.73

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:5.05
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    Decimating Bolt (_tick_t) 100 1.0% 0.0 0.00sec 0 0 Direct 19.9 1257 2514 1503 19.6%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 19.95 0.00 0.00 0.0000 0.0000 29981.14 29981.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.41% 16.04 9 27 1257.32 899 1674 1254.69 1130 1365 20165 20165 0.00%
crit 19.59% 3.91 0 12 2513.72 1799 3348 2440.35 0 3342 9816 9816 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1607 16.6% 27.0 10.80sec 17805 14107 Direct 34.5 1540 3064 1831 19.2%
Periodic 345.7 1014 2027 1210 19.3% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.04 34.52 345.68 345.68 1.2621 2.4820 481414.73 481414.73 0.00% 539.63 14107.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 27.89 15 39 1540.15 821 2017 1540.89 1416 1685 42955 42955 0.00%
crit 19.22% 6.63 0 15 3064.21 1646 4032 3043.45 0 3841 20329 20329 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 278.92 215 354 1013.85 1 1261 1014.04 993 1031 282796 282796 0.00%
crit 19.31% 66.76 36 99 2027.31 11 2521 2027.37 1925 2120 135334 135334 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.42
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.76
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 813 8.4% 40.8 6.64sec 5979 4066 Direct 50.5 (50.5) 4033 8150 4841 19.6% (19.6%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.83 50.47 0.00 0.00 1.4706 0.0000 244135.94 244135.94 0.00% 4065.54 4065.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 40.57 21 61 4033.50 1319 8885 4041.50 3355 4844 163584 163584 0.00%
crit 19.61% 9.90 3 21 8149.59 2782 17478 8156.78 4171 13349 80552 80552 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.09
    havoc
    [R]:10.00
  • if_expr:cast_time<havoc_remains
Rain of Fire 867 9.0% 16.6 16.86sec 15647 12504 Periodic 393.6 553 1105 659 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.59 0.00 0.00 393.63 1.2514 0.0000 259612.48 259612.48 0.00% 12503.61 12503.61
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 317.59 224 424 552.87 507 599 552.86 544 560 175584 175584 0.00%
crit 19.32% 76.04 41 118 1104.99 1013 1198 1105.08 1084 1124 84028 84028 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.06
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.52
Soul Fire 506 5.2% 5.6 49.31sec 27124 7800 Direct 7.5 17083 34001 20172 18.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.50 0.00 0.00 3.4775 0.0000 151166.57 151166.57 0.00% 7800.13 7800.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.82% 6.13 3 10 17083.12 8616 21171 17107.07 14880 20564 104818 104818 0.00%
crit 18.18% 1.36 0 5 34000.72 17367 42305 26651.66 0 42235 46348 46348 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.68
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.97
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.53sec 11986 10368 Direct 6.0 3348 6696 3996 19.3%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23971.36 23971.36 0.00% 10368.23 10368.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 4.84 1 6 3348.13 3348 3348 3348.13 3348 3348 16206 16206 0.00%
crit 19.33% 1.16 0 5 6696.27 6696 6696 4738.90 0 6696 7765 7765 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3824 / 775
Immolation 3559 7.4% 39.0 5.49sec 5475 0 Direct 117.0 1529 3061 1825 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213537.88 213537.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 94.38 81 107 1528.90 1395 2023 1528.90 1496 1556 144294 144294 0.00%
crit 19.34% 22.62 10 36 3060.85 2790 4046 3060.63 2851 3304 69244 69244 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15906.98 22721.53 29.99% 270.05 270.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 33.14 25 39 325.55 326 326 325.55 326 326 10788 15410 29.99%
crit 19.17% 7.86 2 16 651.10 651 651 651.10 651 651 5119 7312 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 93.2 3.21sec 1651 1134 Direct 92.5 1395 2790 1663 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 153882.75 153882.75 0.00% 1133.87 1133.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 74.69 55 95 1395.06 1395 1395 1395.06 1395 1395 104197 104197 0.00%
crit 19.25% 17.81 9 30 2790.11 2790 2790 2790.11 2790 2790 49685 49685 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
Necrolord_Marileth
Havoc 9.6 32.32sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 0.00 0.00 1.2439 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.60
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.3sec 52.63% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:52.63%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 5.0 0.0 60.8sec 60.8sec 10.0sec 16.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 73.6s
  • trigger_min/max:47.2s / 73.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.7s

Stack Uptimes

  • decimating_bolt_1:6.55%
  • decimating_bolt_2:6.00%
  • decimating_bolt_3:4.00%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.13% 8.30% 14.58% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Marileth
soul_fire Soul Shard 6.58 7.33 7.81% 1.11 0.23 2.98%
immolate Soul Shard 345.70 33.27 35.44% 0.10 1.30 3.75%
incinerate Soul Shard 40.83 10.15 10.81% 0.25 0.00 0.01%
conflagrate Soul Shard 36.93 28.46 30.31% 0.77 0.00 0.00%
mana_regen Mana 666.17 120616.44 100.00% 181.06 28910.26 19.33%
immolate_crits Soul Shard 33.29 3.21 3.42% 0.10 0.12 3.61%
incinerate_crits Soul Shard 9.90 0.99 1.05% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.47 11.16% 0.09 1.53 12.72%
pet - imp
energy_regen Energy 360.76 3557.58 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 402.44 406.06 28926.7 48914.0 46635.0 50000.0
Soul Shard 4.0 0.31 0.32 3.2 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Necrolord_Marileth
cataclysm Mana 9.7 4828.4 500.0 500.5 48.0
channel_demonfire Mana 12.1 9049.0 750.0 750.2 33.6
chaos_bolt Soul Shard 22.4 44.9 2.0 2.0 12089.0
conflagrate Mana 36.9 18464.6 500.0 499.7 13.3
decimating_bolt Mana 5.0 10070.9 2000.0 2000.3 3.0
havoc Mana 9.6 9597.0 1000.0 1001.3 0.0
immolate Mana 27.0 20285.0 750.0 750.2 23.7
incinerate Mana 40.8 40834.0 1000.0 1000.0 6.0
rain_of_fire Soul Shard 16.6 49.7 3.0 3.0 5219.9
soul_fire Mana 6.6 6584.0 1000.0 1181.4 23.0
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Necrolord_Marileth Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
Necrolord_Marileth Damage Per Second
Count 520
Mean 9686.54
Minimum 9134.57
Maximum 10330.55
Spread ( max - min ) 1195.98
Range [ ( max - min ) / 2 * 100% ] 6.17%
Standard Deviation 214.1136
5th Percentile 9363.95
95th Percentile 10053.28
( 95th Percentile - 5th Percentile ) 689.33
Mean Distribution
Standard Deviation 9.3895
95.00% Confidence Interval ( 9668.13 - 9704.94 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1877
0.1 Scale Factor Error with Delta=300 392
0.05 Scale Factor Error with Delta=300 1566
0.01 Scale Factor Error with Delta=300 39136
Priority Target DPS
Necrolord_Marileth Priority Target Damage Per Second
Count 520
Mean 5390.46
Minimum 5093.58
Maximum 5829.26
Spread ( max - min ) 735.68
Range [ ( max - min ) / 2 * 100% ] 6.82%
Standard Deviation 131.3346
5th Percentile 5169.75
95th Percentile 5605.42
( 95th Percentile - 5th Percentile ) 435.67
Mean Distribution
Standard Deviation 5.7594
95.00% Confidence Interval ( 5379.18 - 5401.75 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2281
0.1 Scale Factor Error with Delta=300 148
0.05 Scale Factor Error with Delta=300 589
0.01 Scale Factor Error with Delta=300 14725
DPS(e)
Necrolord_Marileth Damage Per Second (Effective)
Count 520
Mean 9686.54
Minimum 9134.57
Maximum 10330.55
Spread ( max - min ) 1195.98
Range [ ( max - min ) / 2 * 100% ] 6.17%
Damage
Necrolord_Marileth Damage
Count 520
Mean 2513877.55
Minimum 2044678.19
Maximum 3060810.06
Spread ( max - min ) 1016131.88
Range [ ( max - min ) / 2 * 100% ] 20.21%
DTPS
Necrolord_Marileth Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Marileth Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Marileth Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Marileth Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Marileth Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Marileth Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_MarilethTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Marileth Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.68 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.72 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.06 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.07 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.42 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.60 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.52 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 5.05 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 16.98 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.09 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.95 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.97 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.76 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.54 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.00 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFDFJKLKDLLALEHNQQNPOILKFIELKLLALHNQQRNPEIJFKLLLIK9AHQNQRRPNEILLFKLLFIKLAHRQRNPQ9EJFIKFLKLLAHNQQNQPELKLFMDFFKL9AHQNQQNPDEFJFKILKLLLAHNQQPRN9EIFKLFILKLAHQRNQRPEJKLFIKLLL9AEHQNQNPQNLILFF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.066 cds M summon_infernal Fluffy_Pillow 49783.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.072 aoe H havoc enemy2 49286.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.079 havoc Q chaos_bolt Fluffy_Pillow 48789.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.087 havoc N conflagrate Fluffy_Pillow 49793.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.092 havoc Q chaos_bolt Fluffy_Pillow 49796.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.498 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:11.505 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:12.511 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.918 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:14.926 havoc Q chaos_bolt Fluffy_Pillow 49959.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:16.333 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:17.339 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:18.345 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:20.642 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:21.650 aoe F immolate enemy2 49253.0/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:22.656 aoe D rain_of_fire Fluffy_Pillow 49006.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:23.662 aoe F immolate enemy3 49509.0/50000: 99% mana
0.3/5: 6% soul_shard
bloodlust, backdraft
0:24.669 aoe J decimating_bolt Fluffy_Pillow 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:26.343 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust
0:27.351 aoe L incinerate Fluffy_Pillow 48006.0/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust, backdraft
0:28.291 aoe K conflagrate Fluffy_Pillow 47476.0/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust, decimating_bolt(2)
0:29.299 aoe D rain_of_fire Fluffy_Pillow 47480.0/50000: 95% mana
3.5/5: 70% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:30.305 aoe L incinerate Fluffy_Pillow 47983.0/50000: 96% mana
0.8/5: 16% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:31.244 aoe L incinerate Fluffy_Pillow 47452.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust, decimating_bolt
0:32.584 default A cataclysm Fluffy_Pillow 47122.5/50000: 94% mana
2.0/5: 40% soul_shard
bloodlust
0:33.925 aoe L incinerate Fluffy_Pillow 47293.0/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust
0:35.263 aoe E channel_demonfire Fluffy_Pillow 46962.0/50000: 94% mana
3.0/5: 60% soul_shard
bloodlust
0:37.538 aoe H havoc enemy2 47349.5/50000: 95% mana
3.3/5: 66% soul_shard
bloodlust
0:38.545 havoc N conflagrate Fluffy_Pillow 46853.0/50000: 94% mana
3.4/5: 68% soul_shard
bloodlust
0:39.552 havoc Q chaos_bolt Fluffy_Pillow 46856.5/50000: 94% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:40.959 havoc Q chaos_bolt Fluffy_Pillow 47560.0/50000: 95% mana
2.9/5: 58% soul_shard
bloodlust
0:42.969 havoc N conflagrate Fluffy_Pillow 48565.0/50000: 97% mana
1.2/5: 24% soul_shard
0:44.275 havoc P immolate Fluffy_Pillow 48718.0/50000: 97% mana
2.2/5: 44% soul_shard
backdraft
0:45.582 havoc O soul_fire Fluffy_Pillow 48621.5/50000: 97% mana
2.6/5: 52% soul_shard
backdraft
0:49.058 aoe I rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:50.366 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
0:51.585 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:52.890 aoe F immolate enemy3 49154.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
0:54.196 aoe I rain_of_fire Fluffy_Pillow 49057.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
0:55.504 aoe E channel_demonfire Fluffy_Pillow 49711.5/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
0:58.367 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
0:59.587 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
1:00.894 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
1:02.116 aoe L incinerate Fluffy_Pillow 48767.0/50000: 98% mana
2.2/5: 44% soul_shard
1:03.856 default A cataclysm Fluffy_Pillow 48637.0/50000: 97% mana
2.7/5: 54% soul_shard
1:05.659 aoe L incinerate Fluffy_Pillow 49038.5/50000: 98% mana
2.9/5: 58% soul_shard
1:07.399 aoe H havoc enemy2 48908.5/50000: 98% mana
3.3/5: 66% soul_shard
1:08.844 havoc N conflagrate Fluffy_Pillow 48631.0/50000: 97% mana
3.6/5: 72% soul_shard
1:10.150 havoc Q chaos_bolt Fluffy_Pillow 48784.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
1:11.976 havoc Q chaos_bolt Fluffy_Pillow 49697.0/50000: 99% mana
2.9/5: 58% soul_shard
1:14.584 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
1:16.326 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.7/5: 34% soul_shard
1:17.634 havoc P immolate Fluffy_Pillow 49157.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:18.941 aoe E channel_demonfire Fluffy_Pillow 49060.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
1:21.681 aoe I rain_of_fire Fluffy_Pillow 49680.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
1:22.988 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:25.163 aoe F immolate enemy3 48002.0/50000: 96% mana
1.0/5: 20% soul_shard
backdraft
1:26.469 aoe K conflagrate Fluffy_Pillow 47905.0/50000: 96% mana
1.1/5: 22% soul_shard
1:27.774 aoe L incinerate Fluffy_Pillow 48057.5/50000: 96% mana
1.8/5: 36% soul_shard
backdraft, decimating_bolt(3)
1:28.995 aoe L incinerate Fluffy_Pillow 47668.0/50000: 95% mana
2.1/5: 42% soul_shard
decimating_bolt(2)
1:30.736 aoe L incinerate Fluffy_Pillow 47538.5/50000: 95% mana
2.6/5: 52% soul_shard
decimating_bolt
1:32.476 aoe I rain_of_fire Fluffy_Pillow 47408.5/50000: 95% mana
3.2/5: 64% soul_shard
1:33.783 aoe K conflagrate Fluffy_Pillow 48062.0/50000: 96% mana
0.2/5: 4% soul_shard
1:35.090 default 9 soul_fire Fluffy_Pillow 48215.5/50000: 96% mana
1.2/5: 24% soul_shard
backdraft
1:38.567 default A cataclysm Fluffy_Pillow 48954.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:40.307 aoe H havoc enemy2 49324.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
1:41.614 havoc Q chaos_bolt Fluffy_Pillow 48977.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:43.443 havoc N conflagrate Fluffy_Pillow 49892.0/50000: 100% mana
1.2/5: 24% soul_shard
1:44.751 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
1:46.579 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:48.321 havoc R incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.4/5: 28% soul_shard
1:50.060 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
1:51.366 havoc N conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
2.0/5: 40% soul_shard
1:52.673 aoe E channel_demonfire Fluffy_Pillow 48929.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:55.463 aoe I rain_of_fire Fluffy_Pillow 49574.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
1:56.769 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:57.987 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
1:59.727 aoe F immolate enemy3 48871.5/50000: 98% mana
1.3/5: 26% soul_shard
2:01.033 aoe K conflagrate Fluffy_Pillow 48774.5/50000: 98% mana
1.4/5: 28% soul_shard
2:02.338 aoe L incinerate Fluffy_Pillow 48927.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:03.557 aoe L incinerate Fluffy_Pillow 48536.5/50000: 97% mana
2.4/5: 48% soul_shard
2:05.299 aoe F immolate enemy2 48407.5/50000: 97% mana
2.8/5: 56% soul_shard
2:06.605 aoe I rain_of_fire Fluffy_Pillow 48310.5/50000: 97% mana
3.0/5: 60% soul_shard
2:07.913 aoe K conflagrate Fluffy_Pillow 48964.5/50000: 98% mana
0.2/5: 4% soul_shard
2:09.255 aoe L incinerate Fluffy_Pillow 49135.5/50000: 98% mana
0.9/5: 18% soul_shard
backdraft
2:10.474 default A cataclysm Fluffy_Pillow 48745.0/50000: 97% mana
1.2/5: 24% soul_shard
2:12.214 aoe H havoc enemy2 49115.0/50000: 98% mana
1.6/5: 32% soul_shard
2:13.519 havoc R incinerate Fluffy_Pillow 48767.5/50000: 98% mana
1.6/5: 32% soul_shard
2:15.259 havoc Q chaos_bolt Fluffy_Pillow 48637.5/50000: 97% mana
2.5/5: 50% soul_shard
2:17.868 havoc R incinerate Fluffy_Pillow 49942.0/50000: 100% mana
0.8/5: 16% soul_shard
2:19.608 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
2:20.916 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:22.223 havoc Q chaos_bolt Fluffy_Pillow 49059.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:24.051 default 9 soul_fire Fluffy_Pillow 49973.5/50000: 100% mana
0.9/5: 18% soul_shard
2:27.528 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
2:30.390 aoe J decimating_bolt Fluffy_Pillow 49683.0/50000: 99% mana
2.6/5: 52% soul_shard
2:32.567 aoe F immolate enemy3 48003.0/50000: 96% mana
3.0/5: 60% soul_shard
2:33.874 aoe I rain_of_fire Fluffy_Pillow 47906.5/50000: 96% mana
3.2/5: 64% soul_shard
2:35.181 aoe K conflagrate Fluffy_Pillow 48560.0/50000: 97% mana
0.3/5: 6% soul_shard
decimating_bolt(3)
2:36.487 aoe F immolate enemy2 48713.0/50000: 97% mana
1.0/5: 20% soul_shard
backdraft, decimating_bolt(3)
2:37.793 aoe L incinerate Fluffy_Pillow 48616.0/50000: 97% mana
1.1/5: 22% soul_shard
backdraft, decimating_bolt(3)
2:39.013 aoe K conflagrate Fluffy_Pillow 48226.0/50000: 96% mana
1.5/5: 30% soul_shard
decimating_bolt(2)
2:40.321 aoe L incinerate Fluffy_Pillow 48380.0/50000: 97% mana
2.1/5: 42% soul_shard
backdraft, decimating_bolt(2)
2:41.542 aoe L incinerate Fluffy_Pillow 47990.5/50000: 96% mana
2.6/5: 52% soul_shard
decimating_bolt
2:43.281 default A cataclysm Fluffy_Pillow 47860.0/50000: 96% mana
2.9/5: 58% soul_shard
2:45.021 aoe H havoc enemy2 48230.0/50000: 96% mana
3.3/5: 66% soul_shard
2:46.326 havoc N conflagrate Fluffy_Pillow 47882.5/50000: 96% mana
3.6/5: 72% soul_shard
2:47.632 havoc Q chaos_bolt Fluffy_Pillow 48035.5/50000: 96% mana
4.6/5: 92% soul_shard
backdraft
2:49.460 havoc Q chaos_bolt Fluffy_Pillow 48949.5/50000: 98% mana
2.9/5: 58% soul_shard
2:52.070 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
2:53.375 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
2:55.203 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:56.510 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
2:59.356 aoe L incinerate Fluffy_Pillow 49925.5/50000: 100% mana
1.2/5: 24% soul_shard
3:01.096 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
3:02.403 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
3:03.624 aoe F immolate enemy3 48766.0/50000: 98% mana
2.6/5: 52% soul_shard
3:04.930 cds M summon_infernal Fluffy_Pillow 48669.0/50000: 97% mana
2.8/5: 56% soul_shard
3:06.235 aoe D rain_of_fire Fluffy_Pillow 48321.5/50000: 97% mana
3.1/5: 62% soul_shard
3:07.543 aoe F immolate enemy2 48975.5/50000: 98% mana
0.6/5: 12% soul_shard
3:08.850 aoe F immolate Fluffy_Pillow 48879.0/50000: 98% mana
0.9/5: 18% soul_shard
3:10.158 aoe K conflagrate Fluffy_Pillow 48783.0/50000: 98% mana
1.4/5: 28% soul_shard
3:11.464 aoe L incinerate Fluffy_Pillow 48936.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:12.684 default 9 soul_fire Fluffy_Pillow 48546.0/50000: 97% mana
3.0/5: 60% soul_shard
3:16.161 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
3:17.902 aoe H havoc enemy2 49372.5/50000: 99% mana
5.0/5: 100% soul_shard
3:19.208 havoc Q chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
5.0/5: 100% soul_shard
3:21.816 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:23.123 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:24.951 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.559 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
3:28.865 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
3:30.171 aoe D rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
3:31.477 aoe E channel_demonfire Fluffy_Pillow 49905.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
3:34.388 aoe F immolate enemy2 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
3:35.695 aoe J decimating_bolt Fluffy_Pillow 49252.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
3:37.870 aoe F immolate enemy3 48002.0/50000: 96% mana
2.3/5: 46% soul_shard
3:39.177 aoe K conflagrate Fluffy_Pillow 47905.5/50000: 96% mana
2.5/5: 50% soul_shard
3:40.484 aoe I rain_of_fire Fluffy_Pillow 48059.0/50000: 96% mana
3.2/5: 64% soul_shard
backdraft, decimating_bolt(3)
3:41.791 aoe L incinerate Fluffy_Pillow 48712.5/50000: 97% mana
0.4/5: 8% soul_shard
backdraft, decimating_bolt(3)
3:43.009 aoe K conflagrate Fluffy_Pillow 48321.5/50000: 97% mana
0.7/5: 14% soul_shard
decimating_bolt(2)
3:44.392 aoe L incinerate Fluffy_Pillow 48513.0/50000: 97% mana
1.4/5: 28% soul_shard
backdraft, decimating_bolt(2)
3:45.611 aoe L incinerate Fluffy_Pillow 48122.5/50000: 96% mana
1.7/5: 34% soul_shard
decimating_bolt
3:47.349 aoe L incinerate Fluffy_Pillow 47991.5/50000: 96% mana
2.1/5: 42% soul_shard
3:49.090 default A cataclysm Fluffy_Pillow 47862.0/50000: 96% mana
2.7/5: 54% soul_shard
3:50.830 aoe H havoc enemy2 48232.0/50000: 96% mana
2.8/5: 56% soul_shard
3:52.135 havoc N conflagrate Fluffy_Pillow 47884.5/50000: 96% mana
2.9/5: 58% soul_shard
3:53.441 havoc Q chaos_bolt Fluffy_Pillow 48037.5/50000: 96% mana
4.1/5: 82% soul_shard
backdraft
3:55.268 havoc Q chaos_bolt Fluffy_Pillow 48951.0/50000: 98% mana
2.2/5: 44% soul_shard
3:57.877 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:59.184 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.0/5: 20% soul_shard
4:00.924 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
4:02.231 default 9 soul_fire Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:05.709 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
4:08.588 aoe I rain_of_fire Fluffy_Pillow 49692.0/50000: 99% mana
4.4/5: 88% soul_shard
backdraft
4:09.894 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
4:11.202 aoe K conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.8/5: 36% soul_shard
4:12.507 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
4:13.728 aoe F immolate enemy2 49003.0/50000: 98% mana
2.9/5: 58% soul_shard
4:15.034 aoe I rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
3.1/5: 62% soul_shard
4:16.341 aoe L incinerate Fluffy_Pillow 49559.5/50000: 99% mana
0.2/5: 4% soul_shard
4:18.081 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
4:19.387 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:20.605 default A cataclysm Fluffy_Pillow 48764.0/50000: 98% mana
1.7/5: 34% soul_shard
4:22.566 aoe H havoc enemy2 49244.5/50000: 98% mana
2.0/5: 40% soul_shard
4:23.873 havoc Q chaos_bolt Fluffy_Pillow 48898.0/50000: 98% mana
2.1/5: 42% soul_shard
4:26.482 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:28.223 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
4:29.530 havoc Q chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:31.358 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:33.097 havoc P immolate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
4:34.404 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
1.3/5: 26% soul_shard
4:37.270 aoe J decimating_bolt Fluffy_Pillow 49588.0/50000: 99% mana
2.0/5: 40% soul_shard
4:39.447 aoe K conflagrate Fluffy_Pillow 48003.0/50000: 96% mana
2.2/5: 44% soul_shard
4:40.753 aoe L incinerate Fluffy_Pillow 48156.0/50000: 96% mana
2.9/5: 58% soul_shard
backdraft
4:41.971 aoe F immolate enemy3 47765.0/50000: 96% mana
3.2/5: 64% soul_shard
decimating_bolt(2)
4:43.279 aoe I rain_of_fire Fluffy_Pillow 47669.0/50000: 95% mana
3.4/5: 68% soul_shard
decimating_bolt(2)
4:44.586 aoe K conflagrate Fluffy_Pillow 48322.5/50000: 97% mana
0.5/5: 10% soul_shard
decimating_bolt(2)
4:45.891 aoe L incinerate Fluffy_Pillow 48475.0/50000: 97% mana
1.2/5: 24% soul_shard
backdraft, decimating_bolt(2)
4:47.111 aoe L incinerate Fluffy_Pillow 48085.0/50000: 96% mana
1.6/5: 32% soul_shard
decimating_bolt
4:48.852 aoe L incinerate Fluffy_Pillow 47955.5/50000: 96% mana
2.1/5: 42% soul_shard
4:50.593 default 9 soul_fire Fluffy_Pillow 47826.0/50000: 96% mana
2.4/5: 48% soul_shard
4:54.183 default A cataclysm Fluffy_Pillow 48621.0/50000: 97% mana
4.1/5: 82% soul_shard
4:55.923 aoe E channel_demonfire Fluffy_Pillow 48991.0/50000: 98% mana
4.2/5: 84% soul_shard
4:58.937 aoe H havoc enemy2 49748.0/50000: 99% mana
4.5/5: 90% soul_shard
5:00.245 havoc Q chaos_bolt Fluffy_Pillow 49402.0/50000: 99% mana
4.5/5: 90% soul_shard
5:02.855 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
5:04.161 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
backdraft
5:05.989 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
5:07.295 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
5:08.603 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
5:10.430 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
5:11.738 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
5:12.958 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.1/5: 62% soul_shard
5:14.264 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
0.5/5: 10% soul_shard
5:16.004 aoe F immolate enemy3 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
5:17.311 aoe F immolate enemy2 48905.5/50000: 98% mana
1.1/5: 22% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necrolord_Marileth"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Dream : 9706 dps, 5242 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9706.4 9706.4 18.4 / 0.189% 797.2 / 8.2% 21.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.5 385.8 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 9706
Cataclysm 774 8.0% 9.7 32.43sec 23931 14084 Direct 29.1 6705 13392 7972 19.0%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 29.05 0.00 0.00 1.6992 0.0000 231759.88 231759.88 0.00% 14084.47 14084.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.98% 23.53 15 33 6705.06 6142 7261 6704.49 6453 6884 157742 157742 0.00%
crit 19.02% 5.53 0 14 13391.91 12283 14520 13316.11 0 14390 74017 74017 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.74
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1023) 0.0% (10.5%) 12.0 25.55sec 25438 9440

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.03 0.00 179.83 0.00 2.6948 0.1635 0.00 0.00 0.00% 9439.61 9439.61

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.05
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1023 10.5% 0.0 0.00sec 0 0 Direct 539.5 476 951 567 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 539.49 0.00 0.00 0.0000 0.0000 306135.95 306135.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 435.27 317 565 475.52 263 976 475.87 450 507 206991 206991 0.00%
crit 19.32% 104.22 64 155 951.02 525 1952 951.43 818 1083 99145 99145 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1304 (1752) 13.4% (18.0%) 21.7 13.13sec 24104 12303 Direct 43.2 (86.0) 0 9036 9036 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.73 43.17 0.00 0.00 1.9592 0.0000 390036.46 390036.46 0.00% 12302.62 12302.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.17 32 58 9035.74 5874 12241 9035.53 8814 9236 390036 390036 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.81
  • if_expr:cast_time<havoc_remains
    Internal Combustion 447 4.6% 42.8 13.13sec 3120 0 Direct 42.8 2622 5241 3121 19.0%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.84 42.84 0.00 0.00 0.0000 0.0000 133661.62 133661.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.97% 34.69 22 48 2622.21 1 3715 2624.62 2346 2826 90964 90964 0.00%
crit 19.03% 8.15 1 17 5241.08 416 7428 5245.87 3591 6642 42698 42698 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 809 8.3% 36.9 7.94sec 6565 5249 Direct 56.6 3589 7141 4281 19.5%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.91 56.60 0.00 0.00 1.2508 0.0000 242306.54 242306.54 0.00% 5248.59 5248.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 45.56 33 62 3588.88 2047 5042 3588.64 3405 3830 163498 163498 0.00%
crit 19.50% 11.04 3 21 7141.40 4095 10083 7134.58 5572 9028 78808 78808 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.23
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.66
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1606 16.6% 26.6 10.87sec 18108 14356 Direct 33.9 1526 3043 1821 19.5%
Periodic 347.0 1014 2026 1209 19.2% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.57 33.89 346.96 346.96 1.2613 2.4832 481175.93 481175.93 0.00% 537.58 14356.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 27.29 16 44 1525.52 819 2017 1525.73 1394 1649 41639 41639 0.00%
crit 19.47% 6.60 1 17 3043.23 1638 4033 3028.08 1923 3767 20073 20073 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 280.18 214 354 1013.97 1 1261 1014.16 994 1035 284095 284095 0.00%
crit 19.25% 66.79 41 95 2026.49 5 2521 2026.94 1915 2103 135369 135369 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.89
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.81
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 615 6.4% 44.7 6.15sec 4132 2820 Direct 55.2 (55.2) 2800 5572 3344 19.6% (19.6%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.65 55.18 0.00 0.00 1.4653 0.0000 184491.91 184491.91 0.00% 2819.68 2819.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.41% 44.37 27 66 2799.77 1319 3426 2803.37 2634 2986 124260 124260 0.00%
crit 19.59% 10.81 1 22 5572.50 2785 6852 5577.26 4110 6624 60232 60232 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.96
    havoc
    [R]:10.93
  • if_expr:cast_time<havoc_remains
Rain of Fire 910 9.4% 17.4 16.79sec 15641 12546 Periodic 413.5 553 1106 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.42 0.00 0.00 413.48 1.2468 0.0000 272426.62 272426.62 0.00% 12545.55 12545.55
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 334.13 220 473 552.78 507 599 552.76 545 559 184695 184695 0.00%
crit 19.19% 79.35 48 120 1105.61 1013 1198 1105.73 1085 1127 87732 87732 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.31
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.10
Soul Fire 505 5.2% 5.5 49.38sec 27311 7854 Direct 7.8 16410 33047 19476 18.5%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.78 0.00 0.00 3.4775 0.0000 151473.00 151473.00 0.00% 7854.04 7854.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.55% 6.34 2 10 16409.52 8608 21174 16459.03 13731 19459 104037 104037 0.00%
crit 18.45% 1.43 0 5 33046.61 17238 42350 26377.42 0 42305 47436 47436 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.37
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.28
  • if_expr:cast_time<havoc_remains
Soul Rot 340 3.5% 5.3 62.41sec 19266 15417 Periodic 96.8 883 1765 1052 19.2% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.28 0.00 96.76 96.76 1.2498 1.2892 101813.30 101813.30 0.00% 775.13 15416.91
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 78.19 53 98 882.88 424 1395 883.19 823 929 69037 69037 0.00%
crit 19.19% 18.57 9 32 1765.27 849 2790 1764.87 1342 2209 32777 32777 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.30
Summon Infernal 81 0.8% 2.0 180.60sec 12021 10394 Direct 6.0 3348 6696 4006 19.7%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24042.18 24042.18 0.00% 10394.37 10394.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.32% 4.82 2 6 3348.13 3348 3348 3348.13 3348 3348 16135 16135 0.00%
crit 19.68% 1.18 0 4 6696.27 6696 6696 5009.33 0 6696 7907 7907 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3831 / 777
Immolation 3565 7.4% 39.0 5.49sec 5485 0 Direct 117.0 1529 3063 1828 19.5%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213931.82 213931.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 94.13 79 106 1528.67 1395 2023 1528.72 1496 1557 143900 143900 0.00%
crit 19.55% 22.87 11 38 3062.71 2790 4046 3061.97 2837 3316 70032 70032 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15927.01 22750.15 29.99% 270.39 270.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 33.08 24 40 325.55 326 326 325.55 326 326 10768 15381 29.99%
crit 19.32% 7.92 1 17 651.10 651 651 651.10 651 651 5159 7369 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 93.2 3.21sec 1652 1135 Direct 92.5 1395 2790 1665 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 153973.97 153973.97 0.00% 1134.55 1134.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 74.62 55 98 1395.06 1395 1395 1395.06 1395 1395 104106 104106 0.00%
crit 19.32% 17.87 6 32 2790.11 2790 2790 2790.11 2790 2790 49868 49868 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
NightFae_Dream
Havoc 9.6 32.02sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 0.00 0.00 0.00 1.2443 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.65
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.9 0.0 8.0sec 8.0sec 4.1sec 50.31% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.2s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.31%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.91% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.4s
  • trigger_min/max:61.3s / 68.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.91%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.9s
  • trigger_min/max:180.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.9s
  • trigger_min/max:180.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.31% 11.42% 17.28% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
soul_fire Soul Shard 6.56 7.19 7.57% 1.10 0.64 8.16%
immolate Soul Shard 346.96 33.56 35.34% 0.10 1.13 3.26%
incinerate Soul Shard 44.65 11.09 11.68% 0.25 0.01 0.06%
conflagrate Soul Shard 36.89 28.27 29.77% 0.77 0.00 0.00%
mana_regen Mana 658.79 115635.12 100.00% 175.53 33912.05 22.68%
immolate_crits Soul Shard 33.43 3.23 3.40% 0.10 0.11 3.38%
incinerate_crits Soul Shard 10.83 1.08 1.14% 0.10 0.00 0.05%
infernal Soul Shard 120.00 10.55 11.11% 0.09 1.45 12.05%
pet - imp
energy_regen Energy 360.75 3557.55 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 385.82 388.49 33924.8 49199.0 47765.0 50000.0
Soul Shard 4.0 0.32 0.32 3.3 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Dream
cataclysm Mana 9.7 4847.0 500.0 500.5 47.8
channel_demonfire Mana 12.0 9036.4 750.0 750.9 33.9
chaos_bolt Soul Shard 21.7 43.4 2.0 2.0 12063.9
conflagrate Mana 36.9 18445.9 500.0 499.8 13.1
havoc Mana 9.6 9649.3 1000.0 1000.3 0.0
immolate Mana 26.6 19928.2 750.0 749.9 24.1
incinerate Mana 44.7 44654.9 1000.0 1000.1 4.1
rain_of_fire Soul Shard 17.4 52.2 3.0 3.0 5214.7
soul_fire Mana 6.6 6557.8 1000.0 1182.4 23.1
soul_rot Mana 5.3 1319.0 250.0 249.6 77.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
NightFae_Dream Damage Per Second
Count 520
Mean 9706.35
Minimum 9207.32
Maximum 10317.99
Spread ( max - min ) 1110.66
Range [ ( max - min ) / 2 * 100% ] 5.72%
Standard Deviation 213.6177
5th Percentile 9380.82
95th Percentile 10061.69
( 95th Percentile - 5th Percentile ) 680.87
Mean Distribution
Standard Deviation 9.3678
95.00% Confidence Interval ( 9687.99 - 9724.71 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1861
0.1 Scale Factor Error with Delta=300 390
0.05 Scale Factor Error with Delta=300 1559
0.01 Scale Factor Error with Delta=300 38955
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 520
Mean 5242.36
Minimum 4903.60
Maximum 5607.77
Spread ( max - min ) 704.16
Range [ ( max - min ) / 2 * 100% ] 6.72%
Standard Deviation 126.4408
5th Percentile 5049.67
95th Percentile 5473.38
( 95th Percentile - 5th Percentile ) 423.71
Mean Distribution
Standard Deviation 5.5448
95.00% Confidence Interval ( 5231.49 - 5253.22 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2235
0.1 Scale Factor Error with Delta=300 137
0.05 Scale Factor Error with Delta=300 546
0.01 Scale Factor Error with Delta=300 13648
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 520
Mean 9706.35
Minimum 9207.32
Maximum 10317.99
Spread ( max - min ) 1110.66
Range [ ( max - min ) / 2 * 100% ] 5.72%
Damage
NightFae_Dream Damage
Count 520
Mean 2519323.39
Minimum 1992607.75
Maximum 3034565.46
Spread ( max - min ) 1041957.71
Range [ ( max - min ) / 2 * 100% ] 20.68%
DTPS
NightFae_Dream Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.37 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.74 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.31 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.30 soul_rot
F 12.05 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.89 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.65 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.10 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.23 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.96 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.66 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.28 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.81 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.81 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.93 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGDGLKLLDKALLJFINQRNOPJLGKJLFKLAELJIRRNQNQPFGGKLLLL9AIQNQNQPNFJLGLGGKLEJKAIRQRNQP9FKGJLKLGLLAINQQRNPFJLKLGMLDEK9AFIQNQNPQDLLGKFGGJLAKIRNQRQPN9FGEJKLLLAINQQNQPFLKLGGJGKLLLA9FIQNQNPQNEGJLG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E soul_rot Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.747 aoe F channel_demonfire Fluffy_Pillow 49623.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.982 cds M summon_infernal Fluffy_Pillow 49991.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:05.989 aoe I havoc enemy2 49494.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:06.997 havoc Q chaos_bolt Fluffy_Pillow 48998.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:09.006 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.013 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft, soul_rot
0:11.418 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:12.423 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:13.429 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:14.835 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.841 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.248 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:18.255 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.263 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:21.748 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.752 aoe G immolate enemy2 49251.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.759 aoe D rain_of_fire Fluffy_Pillow 49004.5/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.766 aoe G immolate enemy3 49508.0/50000: 99% mana
0.3/5: 6% soul_shard
bloodlust, backdraft
0:25.773 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
bloodlust, backdraft
0:26.712 aoe K conflagrate Fluffy_Pillow 48722.0/50000: 97% mana
1.2/5: 24% soul_shard
bloodlust
0:27.716 aoe L incinerate Fluffy_Pillow 48724.0/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:28.656 aoe L incinerate Fluffy_Pillow 48194.0/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust
0:29.995 aoe D rain_of_fire Fluffy_Pillow 47863.5/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust
0:31.002 aoe K conflagrate Fluffy_Pillow 48367.0/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust
0:32.010 default A cataclysm Fluffy_Pillow 48371.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:33.350 aoe L incinerate Fluffy_Pillow 48541.0/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:34.290 aoe L incinerate Fluffy_Pillow 48011.0/50000: 96% mana
2.8/5: 56% soul_shard
bloodlust
0:35.630 aoe J rain_of_fire Fluffy_Pillow 47681.0/50000: 95% mana
3.2/5: 64% soul_shard
bloodlust
0:36.637 aoe F channel_demonfire Fluffy_Pillow 48184.5/50000: 96% mana
0.6/5: 12% soul_shard
bloodlust
0:38.914 aoe I havoc enemy2 48573.0/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:39.921 havoc N conflagrate Fluffy_Pillow 48076.5/50000: 96% mana
1.4/5: 28% soul_shard
bloodlust
0:40.927 havoc Q chaos_bolt Fluffy_Pillow 48079.5/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:42.333 havoc R incinerate Fluffy_Pillow 48782.5/50000: 98% mana
0.7/5: 14% soul_shard
0:44.074 havoc N conflagrate Fluffy_Pillow 48653.0/50000: 97% mana
1.1/5: 22% soul_shard
0:45.380 havoc O soul_fire Fluffy_Pillow 48806.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
0:48.858 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
0:50.165 aoe J rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.472 aoe L incinerate Fluffy_Pillow 49559.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
0:52.693 aoe G immolate enemy3 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
0:53.998 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.5/5: 50% soul_shard
0:55.304 aoe J rain_of_fire Fluffy_Pillow 49058.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
0:56.610 aoe L incinerate Fluffy_Pillow 49711.5/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
0:57.830 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
1:00.674 aoe K conflagrate Fluffy_Pillow 49674.5/50000: 99% mana
1.2/5: 24% soul_shard
1:01.979 aoe L incinerate Fluffy_Pillow 49827.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
1:03.198 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
1:05.087 aoe E soul_rot Fluffy_Pillow 49446.5/50000: 99% mana
2.2/5: 44% soul_shard
1:06.396 aoe L incinerate Fluffy_Pillow 49753.5/50000: 100% mana
2.5/5: 50% soul_shard
soul_rot
1:08.134 aoe J rain_of_fire Fluffy_Pillow 49001.0/50000: 98% mana
3.0/5: 60% soul_shard
soul_rot
1:09.439 aoe I havoc enemy2 49653.5/50000: 99% mana
0.0/5: 0% soul_shard
soul_rot
1:10.746 havoc R incinerate Fluffy_Pillow 49307.0/50000: 99% mana
0.4/5: 8% soul_shard
soul_rot
1:12.486 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
soul_rot
1:14.228 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
1.6/5: 32% soul_shard
soul_rot
1:15.534 havoc Q chaos_bolt Fluffy_Pillow 49026.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:17.363 havoc N conflagrate Fluffy_Pillow 49940.5/50000: 100% mana
1.0/5: 20% soul_shard
1:18.668 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
1:20.498 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
1:21.804 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
1:24.568 aoe G immolate enemy3 49884.0/50000: 100% mana
0.8/5: 16% soul_shard
1:25.874 aoe G immolate enemy2 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
1:27.181 aoe K conflagrate Fluffy_Pillow 49155.5/50000: 98% mana
1.0/5: 20% soul_shard
1:28.487 aoe L incinerate Fluffy_Pillow 49308.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
1:29.706 aoe L incinerate Fluffy_Pillow 48918.0/50000: 98% mana
1.9/5: 38% soul_shard
1:31.447 aoe L incinerate Fluffy_Pillow 48788.5/50000: 98% mana
2.5/5: 50% soul_shard
1:33.189 aoe L incinerate Fluffy_Pillow 48659.5/50000: 97% mana
2.8/5: 56% soul_shard
1:34.931 default 9 soul_fire Fluffy_Pillow 48530.5/50000: 97% mana
3.3/5: 66% soul_shard
1:38.409 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
1:40.149 aoe I havoc enemy2 49372.5/50000: 99% mana
4.9/5: 98% soul_shard
1:41.455 havoc Q chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
5.0/5: 100% soul_shard
1:44.065 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
1:45.373 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
1:47.200 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
1:48.507 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:50.335 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:51.640 havoc N conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
2.0/5: 40% soul_shard
1:53.152 aoe F channel_demonfire Fluffy_Pillow 49507.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
1:56.035 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:57.341 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:58.562 aoe G immolate enemy3 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
1:59.868 aoe L incinerate Fluffy_Pillow 48906.0/50000: 98% mana
1.2/5: 24% soul_shard
2:01.606 aoe G immolate enemy2 48775.0/50000: 98% mana
1.7/5: 34% soul_shard
2:02.912 aoe G immolate Fluffy_Pillow 48678.0/50000: 97% mana
1.8/5: 36% soul_shard
2:04.219 aoe K conflagrate Fluffy_Pillow 48581.5/50000: 97% mana
2.1/5: 42% soul_shard
2:05.525 aoe L incinerate Fluffy_Pillow 48734.5/50000: 97% mana
2.8/5: 56% soul_shard
backdraft
2:06.744 aoe E soul_rot Fluffy_Pillow 48344.0/50000: 97% mana
3.2/5: 64% soul_shard
2:08.051 aoe J rain_of_fire Fluffy_Pillow 48747.5/50000: 97% mana
3.3/5: 66% soul_shard
soul_rot
2:09.357 aoe K conflagrate Fluffy_Pillow 49400.5/50000: 99% mana
0.5/5: 10% soul_shard
soul_rot
2:10.664 default A cataclysm Fluffy_Pillow 49554.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft, soul_rot
2:12.403 aoe I havoc enemy2 49501.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft, soul_rot
2:13.710 havoc R incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft, soul_rot
2:14.930 havoc Q chaos_bolt Fluffy_Pillow 48765.0/50000: 98% mana
2.0/5: 40% soul_shard
soul_rot
2:17.540 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:19.279 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
2:20.585 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:22.414 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:23.721 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
0.6/5: 12% soul_shard
2:27.199 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
2:30.032 aoe K conflagrate Fluffy_Pillow 49669.0/50000: 99% mana
2.5/5: 50% soul_shard
2:31.337 aoe G immolate enemy3 49821.5/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
2:32.644 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
2:33.950 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
2:35.170 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
2:36.477 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
2:37.698 aoe G immolate enemy2 48766.5/50000: 98% mana
1.8/5: 36% soul_shard
2:39.003 aoe L incinerate Fluffy_Pillow 48669.0/50000: 97% mana
1.8/5: 36% soul_shard
2:40.743 aoe L incinerate Fluffy_Pillow 48539.0/50000: 97% mana
2.3/5: 46% soul_shard
2:42.484 default A cataclysm Fluffy_Pillow 48409.5/50000: 97% mana
2.7/5: 54% soul_shard
2:44.224 aoe I havoc enemy2 48779.5/50000: 98% mana
3.0/5: 60% soul_shard
2:45.530 havoc N conflagrate Fluffy_Pillow 48432.5/50000: 97% mana
3.5/5: 70% soul_shard
2:46.837 havoc Q chaos_bolt Fluffy_Pillow 48586.0/50000: 97% mana
4.5/5: 90% soul_shard
backdraft
2:48.664 havoc Q chaos_bolt Fluffy_Pillow 49499.5/50000: 99% mana
2.9/5: 58% soul_shard
2:51.274 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
2:53.016 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.9/5: 38% soul_shard
2:54.324 havoc P immolate Fluffy_Pillow 49157.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:55.630 aoe F channel_demonfire Fluffy_Pillow 49060.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
2:58.419 aoe J rain_of_fire Fluffy_Pillow 49704.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
2:59.726 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
3:00.947 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
3:02.344 aoe L incinerate Fluffy_Pillow 49201.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
3:03.563 aoe G immolate enemy3 48811.0/50000: 98% mana
2.3/5: 46% soul_shard
3:04.868 cds M summon_infernal Fluffy_Pillow 48713.5/50000: 97% mana
2.3/5: 46% soul_shard
3:06.289 aoe L incinerate Fluffy_Pillow 48424.0/50000: 97% mana
2.8/5: 56% soul_shard
3:08.032 aoe D rain_of_fire Fluffy_Pillow 48295.5/50000: 97% mana
3.5/5: 70% soul_shard
3:09.340 aoe E soul_rot Fluffy_Pillow 48949.5/50000: 98% mana
1.0/5: 20% soul_shard
3:10.647 aoe K conflagrate Fluffy_Pillow 49353.0/50000: 99% mana
1.4/5: 28% soul_shard
soul_rot
3:11.955 default 9 soul_fire Fluffy_Pillow 49507.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft, soul_rot
3:15.673 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
4.7/5: 94% soul_shard
backdraft, soul_rot
3:17.413 aoe F channel_demonfire Fluffy_Pillow 49373.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, soul_rot
3:20.382 aoe I havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
backdraft
3:21.689 havoc Q chaos_bolt Fluffy_Pillow 49653.5/50000: 99% mana
5.0/5: 100% soul_shard
3:24.298 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.605 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:27.432 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:28.739 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:30.046 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.9/5: 98% soul_shard
backdraft
3:31.874 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:33.181 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:34.922 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
3:36.663 aoe G immolate enemy3 48873.0/50000: 98% mana
1.7/5: 34% soul_shard
3:37.969 aoe K conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
1.8/5: 36% soul_shard
3:39.276 aoe F channel_demonfire Fluffy_Pillow 48929.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:42.089 aoe G immolate Fluffy_Pillow 49586.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
3:43.394 aoe G immolate enemy2 49251.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
3:44.701 aoe J rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
3:46.009 aoe L incinerate Fluffy_Pillow 49809.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
3:47.229 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
3:49.150 aoe K conflagrate Fluffy_Pillow 49463.0/50000: 99% mana
1.0/5: 20% soul_shard
3:50.457 aoe I havoc enemy2 49616.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
3:51.763 havoc R incinerate Fluffy_Pillow 49269.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
3:52.983 havoc N conflagrate Fluffy_Pillow 48879.5/50000: 98% mana
2.5/5: 50% soul_shard
3:54.290 havoc Q chaos_bolt Fluffy_Pillow 49033.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
3:56.117 havoc R incinerate Fluffy_Pillow 49946.5/50000: 100% mana
1.8/5: 36% soul_shard
3:57.857 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
4:00.466 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
4:01.774 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.0/5: 20% soul_shard
4:03.078 default 9 soul_fire Fluffy_Pillow 49405.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
4:06.556 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:09.455 aoe G immolate enemy3 49702.0/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
4:10.763 aoe E soul_rot Fluffy_Pillow 49253.0/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
4:12.069 aoe J rain_of_fire Fluffy_Pillow 49656.0/50000: 99% mana
4.2/5: 84% soul_shard
soul_rot
4:13.376 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
soul_rot
4:14.682 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft, soul_rot
4:15.903 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.3/5: 46% soul_shard
soul_rot
4:17.643 aoe L incinerate Fluffy_Pillow 48873.0/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot
4:19.384 default A cataclysm Fluffy_Pillow 48743.5/50000: 97% mana
3.3/5: 66% soul_shard
soul_rot
4:21.123 aoe I havoc enemy2 49113.0/50000: 98% mana
3.6/5: 72% soul_shard
4:22.429 havoc N conflagrate Fluffy_Pillow 48766.0/50000: 98% mana
3.6/5: 72% soul_shard
4:23.735 havoc Q chaos_bolt Fluffy_Pillow 48919.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
4:25.562 havoc Q chaos_bolt Fluffy_Pillow 49832.5/50000: 100% mana
3.0/5: 60% soul_shard
4:28.172 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
4:29.479 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
4:31.307 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:32.613 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
4:35.479 aoe L incinerate Fluffy_Pillow 49935.0/50000: 100% mana
1.2/5: 24% soul_shard
4:37.220 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
4:38.526 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:39.746 aoe G immolate enemy3 48765.5/50000: 98% mana
2.7/5: 54% soul_shard
4:41.052 aoe G immolate enemy2 48668.5/50000: 97% mana
2.9/5: 58% soul_shard
4:42.360 aoe J rain_of_fire Fluffy_Pillow 48572.5/50000: 97% mana
3.0/5: 60% soul_shard
4:43.667 aoe G immolate Fluffy_Pillow 49226.0/50000: 98% mana
0.2/5: 4% soul_shard
4:44.974 aoe K conflagrate Fluffy_Pillow 49129.5/50000: 98% mana
0.4/5: 8% soul_shard
4:46.282 aoe L incinerate Fluffy_Pillow 49283.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
4:47.502 aoe L incinerate Fluffy_Pillow 48893.5/50000: 98% mana
1.5/5: 30% soul_shard
4:49.242 aoe L incinerate Fluffy_Pillow 48763.5/50000: 98% mana
1.9/5: 38% soul_shard
4:50.984 default A cataclysm Fluffy_Pillow 48634.5/50000: 97% mana
2.4/5: 48% soul_shard
4:52.860 default 9 soul_fire Fluffy_Pillow 49072.5/50000: 98% mana
2.7/5: 54% soul_shard
4:56.337 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.3/5: 86% soul_shard
4:59.089 aoe I havoc enemy2 49628.0/50000: 99% mana
4.6/5: 92% soul_shard
5:00.395 havoc Q chaos_bolt Fluffy_Pillow 49281.0/50000: 99% mana
4.7/5: 94% soul_shard
5:03.005 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:04.313 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
5:06.140 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
5:07.447 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
5:08.754 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
5:10.582 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
5:12.077 aoe E soul_rot Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
5:13.382 aoe G immolate enemy3 49751.5/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, soul_rot
5:14.688 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft, soul_rot
5:15.994 aoe L incinerate Fluffy_Pillow 49905.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, soul_rot
5:17.213 aoe G immolate enemy2 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Dream"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Dream_SB : 9783 dps, 5253 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9782.8 9782.8 18.4 / 0.188% 784.1 / 8.0% 21.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.9 386.1 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 9783
Cataclysm 786 8.0% 9.7 32.32sec 24352 14332 Direct 29.0 6802 13617 8114 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 29.01 0.00 0.00 1.6991 0.0000 235468.18 235468.18 0.00% 14332.47 14332.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 23.41 12 32 6801.67 6142 7454 6802.33 6551 7002 159260 159260 0.00%
crit 19.29% 5.60 0 13 13616.84 12283 14907 13544.18 0 14848 76209 76209 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.75
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1036) 0.0% (10.6%) 12.0 26.19sec 25846 9609

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.00 0.00 179.17 0.00 2.6898 0.1634 0.00 0.00 0.00% 9609.08 9609.08

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:11.99
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1036 10.6% 0.0 0.00sec 0 0 Direct 537.5 484 965 577 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 537.51 0.00 0.00 0.0000 0.0000 310104.27 310104.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 433.67 314 556 483.88 263 1002 484.23 459 512 209866 209866 0.00%
crit 19.32% 103.83 64 149 965.11 525 2004 965.54 844 1139 100239 100239 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1318 (1775) 13.5% (18.1%) 21.6 13.45sec 24559 12532 Direct 43.0 (85.7) 0 9166 9166 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.62 43.04 0.00 0.00 1.9597 0.0000 394452.99 394452.99 0.00% 12532.03 12532.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.04 32 58 9165.73 5866 12567 9165.11 8903 9397 394453 394453 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.74
  • if_expr:cast_time<havoc_remains
    Internal Combustion 457 4.7% 42.7 13.44sec 3198 0 Direct 42.7 2681 5391 3200 19.1%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.71 42.70 0.00 0.00 0.0000 0.0000 136591.99 136591.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 34.53 23 48 2680.62 144 3914 2681.79 2484 2881 92555 92555 0.00%
crit 19.13% 8.17 2 17 5390.88 221 7803 5396.99 3582 6625 44037 44037 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 821 8.4% 36.9 7.94sec 6656 5322 Direct 56.6 3631 7276 4338 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.90 56.62 0.00 0.00 1.2507 0.0000 245601.40 245601.40 0.00% 5321.58 5321.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 45.63 30 63 3630.96 2047 5177 3631.70 3402 3913 165702 165702 0.00%
crit 19.41% 10.99 3 22 7276.17 4094 10352 7273.62 5297 8551 79899 79899 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.19
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.70
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1630 16.7% 26.7 10.83sec 18296 14503 Direct 33.8 1551 3110 1851 19.3%
Periodic 347.0 1027 2053 1226 19.4% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.68 33.85 347.00 347.00 1.2615 2.4832 488210.23 488210.23 0.00% 545.29 14502.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 27.32 16 39 1550.72 822 2071 1551.14 1451 1665 42374 42374 0.00%
crit 19.28% 6.53 1 14 3110.03 1641 4141 3105.48 2124 4082 20281 20281 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.59% 279.64 211 347 1027.31 0 1294 1027.41 1006 1045 287290 287290 0.00%
crit 19.41% 67.36 42 99 2052.84 1 2588 2053.05 1955 2175 138266 138266 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.97
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.81
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 622 6.4% 44.7 6.10sec 4173 2849 Direct 55.3 (55.3) 2833 5642 3372 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.73 55.35 0.00 0.00 1.4650 0.0000 186662.32 186662.32 0.00% 2848.81 2848.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 44.70 23 65 2832.80 1330 3517 2835.19 2658 3057 126600 126600 0.00%
crit 19.24% 10.65 2 21 5641.59 2664 7034 5651.25 4476 6633 60062 60062 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.92
    havoc
    [R]:11.05
  • if_expr:cast_time<havoc_remains
Rain of Fire 928 9.5% 17.5 16.10sec 15840 12703 Periodic 414.9 560 1121 669 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.52 0.00 0.00 414.91 1.2470 0.0000 277532.18 277532.18 0.00% 12702.86 12702.86
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 334.52 222 461 560.37 507 615 560.36 552 569 187448 187448 0.00%
crit 19.38% 80.39 42 132 1120.66 1013 1230 1120.62 1097 1145 90084 90084 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.34
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.18
Soul Fire 518 5.3% 5.6 49.36sec 27938 8034 Direct 7.9 16590 32975 19782 19.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.86 0.00 0.00 3.4775 0.0000 155111.27 155111.27 0.00% 8034.36 8034.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 6.35 3 11 16589.90 8614 21739 16639.09 13618 19919 105293 105293 0.00%
crit 19.21% 1.51 0 5 32975.40 17284 43094 26429.26 0 42475 49818 49818 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.30
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.35
  • if_expr:cast_time<havoc_remains
Soul Rot 345 3.5% 5.3 62.37sec 19542 15638 Periodic 96.7 895 1780 1068 19.5% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.28 0.00 96.72 96.72 1.2497 1.2891 103270.48 103270.48 0.00% 786.66 15637.56
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.51% 77.87 49 101 895.19 424 1432 895.34 836 946 69699 69699 0.00%
crit 19.49% 18.85 6 31 1780.42 849 2865 1780.78 1345 2250 33571 33571 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.30
Summon Infernal 81 0.8% 2.0 180.62sec 12020 10398 Direct 6.0 3377 6753 4016 18.7%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24039.61 24039.61 0.00% 10397.75 10397.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.35% 4.88 2 6 3377.11 3348 3437 3377.00 3348 3437 16482 16482 0.00%
crit 18.65% 1.12 0 4 6752.57 6696 6875 4817.77 0 6875 7558 7558 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3553 / 720
Immolation 3285 6.7% 39.0 5.49sec 5054 0 Direct 117.0 1414 2828 1685 19.1%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 197119.05 197119.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 94.61 78 107 1414.21 1395 1432 1414.21 1411 1417 133803 133803 0.00%
crit 19.13% 22.39 10 39 2828.33 2790 2865 2828.27 2808 2851 63316 63316 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 268 0.5% 41.0 5.25sec 392 273 Direct 41.0 330 660 392 18.9%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16086.94 22978.59 29.99% 273.11 273.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.08% 33.24 25 39 329.92 326 334 329.92 329 331 10968 15667 29.99%
crit 18.92% 7.76 2 16 660.04 651 668 660.07 651 668 5119 7312 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 521 / 521
Firebolt 521 5.3% 93.2 3.21sec 1672 1148 Direct 92.5 1414 2828 1685 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 155852.43 155852.43 0.00% 1148.36 1148.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 74.78 55 97 1414.07 1395 1432 1414.10 1410 1418 105749 105749 0.00%
crit 19.15% 17.72 8 32 2828.28 2790 2865 2828.19 2805 2852 50103 50103 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
NightFae_Dream_SB
Havoc 9.6 31.95sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.64
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.9 0.0 8.0sec 8.0sec 4.1sec 50.52% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.0s
  • trigger_min/max:2.1s / 24.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.52%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Social Butterfly 30.4 0.0 10.0sec 10.0sec 5.0sec 50.43% 0.00% 0.0 (0.0) 30.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.43%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.91% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.9s
  • trigger_min/max:61.3s / 68.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • soul_rot_1:13.91%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.1s
  • trigger_min/max:180.0s / 187.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.1s
  • trigger_min/max:180.0s / 187.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.20% 10.42% 17.30% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
soul_fire Soul Shard 6.56 7.16 7.53% 1.09 0.74 9.40%
immolate Soul Shard 347.01 33.55 35.29% 0.10 1.15 3.32%
incinerate Soul Shard 44.74 11.13 11.71% 0.25 0.01 0.08%
conflagrate Soul Shard 36.89 28.30 29.77% 0.77 0.00 0.00%
mana_regen Mana 658.55 115734.43 100.00% 175.74 33807.32 22.61%
immolate_crits Soul Shard 33.97 3.29 3.46% 0.10 0.11 3.17%
incinerate_crits Soul Shard 10.62 1.06 1.12% 0.10 0.00 0.09%
infernal Soul Shard 120.00 10.57 11.12% 0.09 1.43 11.93%
pet - imp
energy_regen Energy 360.76 3557.58 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.14 388.86 33825.2 49184.8 47872.0 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
cataclysm Mana 9.7 4839.6 500.0 500.5 48.7
channel_demonfire Mana 12.0 8993.0 750.0 749.5 34.5
chaos_bolt Soul Shard 21.6 43.2 2.0 2.0 12287.0
conflagrate Mana 36.9 18445.0 500.0 499.9 13.3
havoc Mana 9.6 9641.8 1000.0 1000.9 0.0
immolate Mana 26.7 20007.9 750.0 749.8 24.4
incinerate Mana 44.7 44738.8 1000.0 1000.3 4.2
rain_of_fire Soul Shard 17.5 52.6 3.0 3.0 5280.7
soul_fire Mana 6.6 6563.4 1000.0 1182.2 23.6
soul_rot Mana 5.3 1319.0 250.0 249.6 78.3
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.8

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
NightFae_Dream_SB Damage Per Second
Count 520
Mean 9782.80
Minimum 9266.62
Maximum 10477.28
Spread ( max - min ) 1210.66
Range [ ( max - min ) / 2 * 100% ] 6.19%
Standard Deviation 213.7590
5th Percentile 9470.01
95th Percentile 10156.77
( 95th Percentile - 5th Percentile ) 686.76
Mean Distribution
Standard Deviation 9.3740
95.00% Confidence Interval ( 9764.42 - 9801.17 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1835
0.1 Scale Factor Error with Delta=300 391
0.05 Scale Factor Error with Delta=300 1561
0.01 Scale Factor Error with Delta=300 39007
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 520
Mean 5253.08
Minimum 4946.04
Maximum 5634.52
Spread ( max - min ) 688.48
Range [ ( max - min ) / 2 * 100% ] 6.55%
Standard Deviation 123.4741
5th Percentile 5062.72
95th Percentile 5461.40
( 95th Percentile - 5th Percentile ) 398.69
Mean Distribution
Standard Deviation 5.4147
95.00% Confidence Interval ( 5242.47 - 5263.69 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2123
0.1 Scale Factor Error with Delta=300 131
0.05 Scale Factor Error with Delta=300 521
0.01 Scale Factor Error with Delta=300 13015
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 520
Mean 9782.80
Minimum 9266.62
Maximum 10477.28
Spread ( max - min ) 1210.66
Range [ ( max - min ) / 2 * 100% ] 6.19%
Damage
NightFae_Dream_SB Damage
Count 520
Mean 2557044.90
Minimum 2065273.38
Maximum 3083841.79
Spread ( max - min ) 1018568.41
Range [ ( max - min ) / 2 * 100% ] 19.92%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.30 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.75 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.34 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.30 soul_rot
F 11.99 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.97 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.64 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.18 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.19 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.92 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.70 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.35 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.81 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.74 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.05 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLJFINQRRNOPGJLKFJLKAELLINQQPRNFGJLKLLLLA9IQNQNQPNFGJLKLLLEAJINQRRNPRFJ9GKJLKLLAIQNQRRPNFJLGKLLMDEGKAIOQNQRDFGGDGKLKLJLLAINQRNQPFLKL9GJEGKJLAINQRRRNPFGJLGKJLLLKLAIQNOPQNFJLGLEKGGJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
social_butterfly
0:01.739 aoe E soul_rot Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, social_butterfly
0:02.746 aoe F channel_demonfire Fluffy_Pillow 49623.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot, social_butterfly
0:04.974 cds M summon_infernal Fluffy_Pillow 49987.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot, social_butterfly
0:05.982 aoe I havoc enemy2 49491.0/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:06.988 havoc Q chaos_bolt Fluffy_Pillow 48994.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:08.995 havoc N conflagrate Fluffy_Pillow 49997.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.000 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft, soul_rot, social_butterfly
0:11.407 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, social_butterfly
0:12.414 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, social_butterfly
0:13.421 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, social_butterfly
0:14.827 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, social_butterfly
0:15.832 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.239 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:18.246 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.251 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:21.602 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, social_butterfly
0:22.608 aoe G immolate enemy2 49252.0/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft, social_butterfly
0:23.615 aoe G immolate enemy3 49005.5/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, social_butterfly
0:24.622 aoe D rain_of_fire Fluffy_Pillow 48759.0/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft, social_butterfly
0:25.629 aoe L incinerate Fluffy_Pillow 49262.5/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.571 aoe K conflagrate Fluffy_Pillow 48733.5/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:27.577 aoe L incinerate Fluffy_Pillow 48736.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.517 aoe L incinerate Fluffy_Pillow 48206.5/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust
0:29.855 aoe D rain_of_fire Fluffy_Pillow 47875.5/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust
0:30.863 aoe K conflagrate Fluffy_Pillow 48379.5/50000: 97% mana
0.5/5: 10% soul_shard
bloodlust, social_butterfly
0:31.871 default A cataclysm Fluffy_Pillow 48383.5/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, backdraft, social_butterfly
0:33.211 aoe L incinerate Fluffy_Pillow 48553.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft, social_butterfly
0:34.150 aoe L incinerate Fluffy_Pillow 48023.0/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust, social_butterfly
0:35.490 aoe J rain_of_fire Fluffy_Pillow 47693.0/50000: 95% mana
3.2/5: 64% soul_shard
bloodlust
0:36.496 aoe F channel_demonfire Fluffy_Pillow 48196.0/50000: 96% mana
0.6/5: 12% soul_shard
bloodlust
0:38.845 aoe I havoc enemy2 48620.5/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:39.852 havoc N conflagrate Fluffy_Pillow 48124.0/50000: 96% mana
1.2/5: 24% soul_shard
bloodlust
0:40.859 havoc Q chaos_bolt Fluffy_Pillow 48127.5/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, social_butterfly
0:42.266 havoc R incinerate Fluffy_Pillow 48831.0/50000: 98% mana
0.5/5: 10% soul_shard
social_butterfly
0:44.004 havoc R incinerate Fluffy_Pillow 48700.0/50000: 97% mana
1.0/5: 20% soul_shard
social_butterfly
0:45.746 havoc N conflagrate Fluffy_Pillow 48571.0/50000: 97% mana
1.8/5: 36% soul_shard
0:47.053 havoc O soul_fire Fluffy_Pillow 48724.5/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
0:50.530 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, social_butterfly
0:51.836 aoe G immolate enemy3 48905.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, social_butterfly
0:53.141 aoe J rain_of_fire Fluffy_Pillow 48807.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, social_butterfly
0:54.447 aoe L incinerate Fluffy_Pillow 49460.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, social_butterfly
0:55.666 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
0:56.972 aoe F channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
0:59.832 aoe J rain_of_fire Fluffy_Pillow 49835.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:01.137 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft, social_butterfly
1:02.357 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
social_butterfly
1:03.665 default A cataclysm Fluffy_Pillow 49156.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft, social_butterfly
1:05.406 aoe E soul_rot Fluffy_Pillow 49502.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
1:06.710 aoe L incinerate Fluffy_Pillow 49751.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft, soul_rot
1:07.931 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.6/5: 52% soul_shard
soul_rot
1:09.672 aoe I havoc enemy2 48873.5/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot
1:10.980 havoc N conflagrate Fluffy_Pillow 48527.5/50000: 97% mana
3.1/5: 62% soul_shard
soul_rot, social_butterfly
1:12.286 havoc Q chaos_bolt Fluffy_Pillow 48680.5/50000: 97% mana
4.2/5: 84% soul_shard
backdraft, soul_rot, social_butterfly
1:14.114 havoc Q chaos_bolt Fluffy_Pillow 49594.5/50000: 99% mana
2.5/5: 50% soul_shard
soul_rot, social_butterfly
1:16.725 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:18.032 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
1:19.774 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.5/5: 30% soul_shard
1:21.081 aoe F channel_demonfire Fluffy_Pillow 49156.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, social_butterfly
1:23.960 aoe G immolate enemy3 49846.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, social_butterfly
1:25.266 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
1:26.571 aoe L incinerate Fluffy_Pillow 49904.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:27.789 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
1:29.097 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
1:30.316 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.9/5: 38% soul_shard
social_butterfly
1:32.057 aoe L incinerate Fluffy_Pillow 48635.5/50000: 97% mana
2.3/5: 46% soul_shard
social_butterfly
1:33.797 aoe L incinerate Fluffy_Pillow 48505.5/50000: 97% mana
2.8/5: 56% soul_shard
social_butterfly
1:35.536 default A cataclysm Fluffy_Pillow 48375.0/50000: 97% mana
3.3/5: 66% soul_shard
1:37.277 default 9 soul_fire Fluffy_Pillow 48745.5/50000: 97% mana
3.7/5: 74% soul_shard
1:40.754 aoe I havoc enemy2 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
social_butterfly
1:42.061 havoc Q chaos_bolt Fluffy_Pillow 48655.5/50000: 97% mana
5.0/5: 100% soul_shard
social_butterfly
1:44.671 havoc N conflagrate Fluffy_Pillow 49960.5/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
1:45.978 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
1:47.805 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
1:49.111 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:50.940 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
social_butterfly
1:52.244 havoc N conflagrate Fluffy_Pillow 49251.0/50000: 99% mana
2.0/5: 40% soul_shard
social_butterfly
1:53.551 aoe F channel_demonfire Fluffy_Pillow 49404.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft, social_butterfly
1:56.484 aoe G immolate enemy3 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
1:57.790 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
1:59.095 aoe L incinerate Fluffy_Pillow 49904.5/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
2:00.314 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
social_butterfly
2:01.787 aoe L incinerate Fluffy_Pillow 49238.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, social_butterfly
2:03.006 aoe L incinerate Fluffy_Pillow 48848.0/50000: 98% mana
2.3/5: 46% soul_shard
social_butterfly
2:04.747 aoe L incinerate Fluffy_Pillow 48718.5/50000: 97% mana
2.8/5: 56% soul_shard
social_butterfly
2:06.488 aoe E soul_rot Fluffy_Pillow 48589.0/50000: 97% mana
3.4/5: 68% soul_shard
2:08.015 default A cataclysm Fluffy_Pillow 49102.5/50000: 98% mana
3.4/5: 68% soul_shard
soul_rot
2:09.757 aoe J rain_of_fire Fluffy_Pillow 49473.5/50000: 99% mana
3.9/5: 78% soul_shard
soul_rot
2:11.065 aoe I havoc enemy2 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
soul_rot, social_butterfly
2:12.372 havoc N conflagrate Fluffy_Pillow 49653.5/50000: 99% mana
1.3/5: 26% soul_shard
soul_rot, social_butterfly
2:13.679 havoc Q chaos_bolt Fluffy_Pillow 49807.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft, soul_rot, social_butterfly
2:15.506 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
soul_rot
2:17.246 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:18.987 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.9/5: 38% soul_shard
2:20.295 havoc P immolate Fluffy_Pillow 49026.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, social_butterfly
2:21.602 havoc R incinerate Fluffy_Pillow 48930.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, social_butterfly
2:22.822 aoe F channel_demonfire Fluffy_Pillow 48540.0/50000: 97% mana
3.9/5: 78% soul_shard
social_butterfly
2:25.626 aoe J rain_of_fire Fluffy_Pillow 49192.0/50000: 98% mana
4.3/5: 86% soul_shard
2:26.932 default 9 soul_fire Fluffy_Pillow 49845.0/50000: 100% mana
1.4/5: 28% soul_shard
2:30.411 aoe G immolate enemy3 49003.0/50000: 98% mana
2.7/5: 54% soul_shard
social_butterfly
2:31.716 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.9/5: 58% soul_shard
social_butterfly
2:33.023 aoe J rain_of_fire Fluffy_Pillow 49059.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, social_butterfly
2:34.331 aoe L incinerate Fluffy_Pillow 49713.0/50000: 99% mana
0.7/5: 14% soul_shard
backdraft, social_butterfly
2:35.552 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
2:36.857 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:38.076 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
2.1/5: 42% soul_shard
2:39.815 default A cataclysm Fluffy_Pillow 48634.5/50000: 97% mana
2.5/5: 50% soul_shard
2:41.556 aoe I havoc enemy2 49005.0/50000: 98% mana
2.8/5: 56% soul_shard
social_butterfly
2:42.863 havoc Q chaos_bolt Fluffy_Pillow 48658.5/50000: 97% mana
2.9/5: 58% soul_shard
social_butterfly
2:45.474 havoc N conflagrate Fluffy_Pillow 49964.0/50000: 100% mana
1.2/5: 24% soul_shard
2:46.781 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
2:48.608 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:50.347 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
social_butterfly
2:52.089 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
social_butterfly
2:53.394 havoc N conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
2.0/5: 40% soul_shard
social_butterfly
2:54.701 aoe F channel_demonfire Fluffy_Pillow 48928.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, social_butterfly
2:57.487 aoe J rain_of_fire Fluffy_Pillow 49571.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
2:58.793 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
3:00.011 aoe G immolate enemy3 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
social_butterfly
3:01.317 aoe K conflagrate Fluffy_Pillow 48904.5/50000: 98% mana
1.3/5: 26% soul_shard
social_butterfly
3:02.622 aoe L incinerate Fluffy_Pillow 49057.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft, social_butterfly
3:03.842 aoe L incinerate Fluffy_Pillow 48667.0/50000: 97% mana
2.3/5: 46% soul_shard
social_butterfly
3:05.582 cds M summon_infernal Fluffy_Pillow 48537.0/50000: 97% mana
2.7/5: 54% soul_shard
3:06.889 aoe D rain_of_fire Fluffy_Pillow 48190.5/50000: 96% mana
3.1/5: 62% soul_shard
3:08.195 aoe E soul_rot Fluffy_Pillow 48843.5/50000: 98% mana
0.6/5: 12% soul_shard
3:09.503 aoe G immolate enemy2 49247.5/50000: 98% mana
1.0/5: 20% soul_shard
soul_rot
3:10.810 aoe K conflagrate Fluffy_Pillow 49151.0/50000: 98% mana
1.4/5: 28% soul_shard
soul_rot, social_butterfly
3:12.116 default A cataclysm Fluffy_Pillow 49304.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, soul_rot, social_butterfly
3:13.857 aoe I havoc enemy2 49502.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, soul_rot, social_butterfly
3:15.164 havoc O soul_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, soul_rot
3:18.883 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:20.710 havoc N conflagrate Fluffy_Pillow 49916.0/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
3:22.017 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, social_butterfly
3:23.845 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
3:25.588 aoe D rain_of_fire Fluffy_Pillow 49003.5/50000: 98% mana
4.1/5: 82% soul_shard
3:26.895 aoe F channel_demonfire Fluffy_Pillow 49657.0/50000: 99% mana
1.5/5: 30% soul_shard
3:29.729 aoe G immolate enemy2 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
3:31.036 aoe G immolate Fluffy_Pillow 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
social_butterfly
3:32.342 aoe D rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.3/5: 66% soul_shard
social_butterfly
3:33.648 aoe G immolate enemy3 49808.5/50000: 100% mana
0.7/5: 14% soul_shard
social_butterfly
3:34.957 aoe K conflagrate Fluffy_Pillow 49253.5/50000: 99% mana
1.1/5: 22% soul_shard
social_butterfly
3:36.263 aoe L incinerate Fluffy_Pillow 49406.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
3:37.481 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.3/5: 46% soul_shard
3:38.788 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:40.008 aoe J rain_of_fire Fluffy_Pillow 48765.0/50000: 98% mana
3.3/5: 66% soul_shard
social_butterfly
3:41.316 aoe L incinerate Fluffy_Pillow 49419.0/50000: 99% mana
0.4/5: 8% soul_shard
social_butterfly
3:43.056 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
social_butterfly
3:44.797 default A cataclysm Fluffy_Pillow 48872.5/50000: 98% mana
1.1/5: 22% soul_shard
social_butterfly
3:46.538 aoe I havoc enemy2 49243.0/50000: 98% mana
1.4/5: 28% soul_shard
3:47.845 havoc N conflagrate Fluffy_Pillow 48896.5/50000: 98% mana
1.6/5: 32% soul_shard
3:49.153 havoc Q chaos_bolt Fluffy_Pillow 49050.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
3:50.981 havoc R incinerate Fluffy_Pillow 49964.5/50000: 100% mana
1.1/5: 22% soul_shard
social_butterfly
3:52.721 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
social_butterfly
3:54.223 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, social_butterfly
3:56.049 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
3:57.355 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.4/5: 28% soul_shard
4:00.064 aoe L incinerate Fluffy_Pillow 49856.5/50000: 100% mana
1.7/5: 34% soul_shard
social_butterfly
4:01.805 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
social_butterfly
4:03.111 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, social_butterfly
4:04.330 default 9 soul_fire Fluffy_Pillow 48765.0/50000: 98% mana
3.3/5: 66% soul_shard
social_butterfly
4:07.807 aoe G immolate enemy3 49002.0/50000: 98% mana
4.7/5: 94% soul_shard
4:09.114 aoe J rain_of_fire Fluffy_Pillow 48905.5/50000: 98% mana
5.0/5: 100% soul_shard
4:10.421 aoe E soul_rot Fluffy_Pillow 49559.0/50000: 99% mana
2.0/5: 40% soul_shard
social_butterfly
4:11.728 aoe G immolate enemy2 49752.5/50000: 100% mana
2.4/5: 48% soul_shard
soul_rot, social_butterfly
4:13.036 aoe K conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
2.4/5: 48% soul_shard
soul_rot, social_butterfly
4:14.343 aoe J rain_of_fire Fluffy_Pillow 49406.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, soul_rot, social_butterfly
4:15.649 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, soul_rot
4:16.869 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
soul_rot
4:18.609 aoe I havoc enemy2 49372.5/50000: 99% mana
0.9/5: 18% soul_shard
soul_rot
4:19.917 havoc N conflagrate Fluffy_Pillow 49026.5/50000: 98% mana
1.2/5: 24% soul_shard
4:21.225 havoc Q chaos_bolt Fluffy_Pillow 49180.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft, social_butterfly
4:23.051 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
social_butterfly
4:24.791 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
social_butterfly
4:26.531 havoc R incinerate Fluffy_Pillow 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
4:28.272 havoc N conflagrate Fluffy_Pillow 48742.5/50000: 97% mana
2.5/5: 50% soul_shard
4:29.578 havoc P immolate Fluffy_Pillow 48895.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
4:30.883 aoe F channel_demonfire Fluffy_Pillow 48798.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft, social_butterfly
4:33.597 aoe G immolate enemy2 49405.0/50000: 99% mana
4.4/5: 88% soul_shard
backdraft, social_butterfly
4:34.904 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.6/5: 92% soul_shard
backdraft, social_butterfly
4:36.210 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
4:37.429 aoe G immolate enemy3 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
4:38.736 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.3/5: 46% soul_shard
4:40.043 aoe J rain_of_fire Fluffy_Pillow 49059.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, social_butterfly
4:41.350 aoe L incinerate Fluffy_Pillow 49712.5/50000: 99% mana
0.1/5: 2% soul_shard
backdraft, social_butterfly
4:42.568 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.5/5: 10% soul_shard
social_butterfly
4:44.309 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
0.8/5: 16% soul_shard
social_butterfly
4:46.050 aoe K conflagrate Fluffy_Pillow 48742.5/50000: 97% mana
1.4/5: 28% soul_shard
4:47.357 aoe L incinerate Fluffy_Pillow 48896.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
4:48.577 default A cataclysm Fluffy_Pillow 48506.0/50000: 97% mana
2.5/5: 50% soul_shard
4:50.345 aoe I havoc enemy2 48890.0/50000: 98% mana
2.8/5: 56% soul_shard
social_butterfly
4:51.652 havoc Q chaos_bolt Fluffy_Pillow 48543.5/50000: 97% mana
3.0/5: 60% soul_shard
social_butterfly
4:54.261 havoc N conflagrate Fluffy_Pillow 49848.0/50000: 100% mana
1.3/5: 26% soul_shard
social_butterfly
4:55.566 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
4:59.042 havoc P immolate Fluffy_Pillow 49001.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
5:00.348 havoc Q chaos_bolt Fluffy_Pillow 48904.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft, social_butterfly
5:02.176 havoc N conflagrate Fluffy_Pillow 49818.5/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
5:03.483 aoe F channel_demonfire Fluffy_Pillow 49972.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft, social_butterfly
5:06.263 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
5:07.570 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
5:08.789 aoe G immolate enemy3 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
5:10.096 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
2.1/5: 42% soul_shard
social_butterfly
5:11.837 aoe E soul_rot Fluffy_Pillow 48776.0/50000: 98% mana
2.7/5: 54% soul_shard
social_butterfly
5:13.144 aoe K conflagrate Fluffy_Pillow 49179.5/50000: 98% mana
2.7/5: 54% soul_shard
soul_rot, social_butterfly
5:14.451 aoe G immolate Fluffy_Pillow 49333.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft, soul_rot, social_butterfly
5:15.760 aoe G immolate enemy2 49237.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, soul_rot
5:17.067 aoe J rain_of_fire Fluffy_Pillow 49141.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft, soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Dream_SB"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=319210/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Koraylon : 9925 dps, 5324 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9924.8 9924.8 18.9 / 0.191% 813.6 / 8.2% 22.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.8 386.3 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon 9925
Cataclysm 798 8.0% 9.7 32.39sec 24679 14525 Direct 29.0 6897 13795 8225 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 29.04 0.00 0.00 1.6991 0.0000 238862.07 238862.07 0.00% 14524.91 14524.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 23.44 14 32 6896.79 6141 7987 6897.49 6706 7158 161645 161645 0.00%
crit 19.28% 5.60 0 12 13794.80 12283 15971 13757.63 0 15008 77217 77217 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.74
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1061) 0.0% (10.7%) 12.1 25.51sec 26297 9770

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.07 0.00 180.29 0.00 2.6916 0.1633 0.00 0.00 0.00% 9770.46 9770.46

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.07
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1061 10.7% 0.0 0.00sec 0 0 Direct 540.9 493 986 587 19.1%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 540.87 0.00 0.00 0.0000 0.0000 317540.01 317540.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 437.33 310 567 492.89 263 1074 493.09 467 521 215511 215511 0.00%
crit 19.14% 103.54 65 144 985.57 525 2147 985.93 817 1136 102029 102029 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1337 (1814) 13.5% (18.3%) 21.6 13.43sec 25140 12827 Direct 42.9 (85.5) 0 9321 9321 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.57 42.90 0.00 0.00 1.9600 0.0000 399873.61 399873.61 0.00% 12826.96 12826.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.90 32 58 9320.60 5870 13464 9319.85 9063 9537 399874 399874 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.65
  • if_expr:cast_time<havoc_remains
    Internal Combustion 477 4.8% 42.6 13.44sec 3342 0 Direct 42.6 2813 5588 3342 19.0%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.61 42.60 0.00 0.00 0.0000 0.0000 142385.99 142385.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.97% 34.49 23 47 2813.05 1 4496 2814.57 2604 3158 97036 97036 0.00%
crit 19.03% 8.11 0 18 5588.09 447 8992 5598.44 0 7267 45350 45350 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 833 8.4% 36.9 7.95sec 6759 5404 Direct 56.7 3695 7396 4401 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.90 56.67 0.00 0.00 1.2508 0.0000 249395.82 249395.82 0.00% 5403.68 5403.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.95% 45.87 28 60 3695.23 2047 5546 3695.37 3465 3957 169481 169481 0.00%
crit 19.05% 10.80 3 21 7396.26 4095 11089 7397.70 5165 8838 79914 79914 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.13
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.76
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1650 16.7% 26.7 10.77sec 18541 14698 Direct 33.9 1568 3138 1871 19.4%
Periodic 346.9 1042 2085 1242 19.2% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.66 33.90 346.93 346.93 1.2615 2.4842 494304.78 494304.78 0.00% 552.02 14698.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 27.34 17 41 1567.85 819 2218 1567.86 1462 1685 42849 42849 0.00%
crit 19.36% 6.56 0 16 3138.04 1641 4436 3131.55 0 4260 20598 20598 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.80% 280.33 207 353 1041.67 0 1387 1041.81 1024 1061 292029 292029 0.00%
crit 19.20% 66.60 41 101 2084.55 3 2773 2084.65 1937 2236 138828 138828 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.97
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.79
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 629 6.4% 44.7 6.16sec 4225 2885 Direct 55.3 (55.3) 2851 5736 3413 19.5% (19.5%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.68 55.27 0.00 0.00 1.4641 0.0000 188744.59 188744.59 0.00% 2885.47 2885.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 44.48 28 64 2851.36 1316 3768 2854.90 2647 3078 126860 126860 0.00%
crit 19.52% 10.79 3 24 5735.70 2696 7537 5727.88 4458 6641 61885 61885 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.97
    havoc
    [R]:11.00
  • if_expr:cast_time<havoc_remains
Rain of Fire 945 9.5% 17.5 16.30sec 16121 12935 Periodic 415.7 570 1140 680 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.54 0.00 0.00 415.71 1.2464 0.0000 282829.19 282829.19 0.00% 12934.66 12934.66
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 335.39 224 461 570.15 507 659 570.34 561 582 191225 191225 0.00%
crit 19.32% 80.32 49 118 1140.42 1013 1318 1140.74 1113 1178 91604 91604 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.32
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.23
Soul Fire 532 5.4% 5.6 49.44sec 28686 8249 Direct 7.9 17029 33790 20270 19.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.86 0.00 0.00 3.4775 0.0000 159260.07 159260.07 0.00% 8249.25 8249.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 6.34 3 11 17029.10 8616 23252 17097.13 13961 20694 107918 107918 0.00%
crit 19.36% 1.52 0 5 33790.50 17447 46560 26876.95 0 46412 51342 51342 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.26
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.37
  • if_expr:cast_time<havoc_remains
Soul Rot 352 3.6% 5.3 62.61sec 20014 16017 Periodic 96.6 914 1834 1092 19.3% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.27 0.00 96.63 96.63 1.2496 1.2894 105458.41 105458.41 0.00% 803.93 16017.38
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 77.95 51 99 913.55 424 1535 913.19 858 956 71186 71186 0.00%
crit 19.33% 18.68 6 31 1834.05 849 3069 1836.27 1439 2327 34272 34272 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.30
Summon Infernal 85 0.8% 2.0 180.52sec 12510 10817 Direct 6.0 3514 7042 4171 18.6%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 25020.87 25020.87 0.00% 10817.50 10817.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.41% 4.88 1 6 3514.33 3348 3683 3514.03 3348 3683 17166 17166 0.00%
crit 18.59% 1.12 0 5 7041.70 6696 7366 4918.67 0 7366 7855 7855 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3508 / 711
Immolation 3244 6.6% 39.0 5.49sec 4990 0 Direct 117.0 1395 2790 1663 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194621.08 194621.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 94.49 80 106 1395.06 1395 1395 1395.06 1395 1395 131822 131822 0.00%
crit 19.24% 22.51 11 37 2790.11 2790 2790 2790.11 2790 2790 62799 62799 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15893.83 22702.75 29.99% 269.83 269.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.92% 33.18 24 40 325.55 326 326 325.55 326 326 10801 15429 29.99%
crit 19.08% 7.82 1 17 651.10 651 651 651.10 651 651 5092 7274 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.2% 93.2 3.21sec 1654 1136 Direct 92.5 1395 2790 1668 19.5%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 154188.59 154188.59 0.00% 1136.11 1136.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.51% 74.47 53 96 1395.06 1395 1395 1395.06 1395 1395 103891 103891 0.00%
crit 19.49% 18.03 5 34 2790.11 2790 2790 2790.11 2790 2790 50297 50297 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
NightFae_Koraylon
Havoc 9.6 32.06sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.63
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.9 0.0 8.0sec 8.0sec 4.1sec 50.61% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.1s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.61%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.5sec 62.5sec 7.9sec 13.90% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.4s
  • trigger_min/max:61.3s / 68.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • soul_rot_1:13.90%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 188.1s
  • trigger_min/max:180.0s / 188.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 188.1s
  • trigger_min/max:180.0s / 188.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.17% 10.40% 18.00% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon
soul_fire Soul Shard 6.57 7.17 7.55% 1.09 0.75 9.50%
immolate Soul Shard 346.95 33.54 35.32% 0.10 1.15 3.33%
incinerate Soul Shard 44.70 11.12 11.70% 0.25 0.01 0.09%
conflagrate Soul Shard 36.89 28.33 29.83% 0.77 0.00 0.00%
mana_regen Mana 659.65 115774.02 100.00% 175.51 33770.05 22.58%
immolate_crits Soul Shard 33.39 3.23 3.40% 0.10 0.11 3.29%
incinerate_crits Soul Shard 10.77 1.08 1.13% 0.10 0.00 0.10%
infernal Soul Shard 120.00 10.51 11.07% 0.09 1.49 12.39%
pet - imp
energy_regen Energy 360.75 3557.58 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.25 388.80 33789.0 49236.6 47935.0 50000.0
Soul Shard 4.0 0.32 0.32 3.5 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Koraylon
cataclysm Mana 9.7 4844.2 500.0 500.5 49.3
channel_demonfire Mana 12.1 9050.4 750.0 749.5 35.1
chaos_bolt Soul Shard 21.5 43.1 2.0 2.0 12585.6
conflagrate Mana 36.9 18445.9 500.0 499.9 13.5
havoc Mana 9.6 9632.5 1000.0 1000.8 0.0
immolate Mana 26.6 19978.5 750.0 749.4 24.7
incinerate Mana 44.7 44703.4 1000.0 1000.6 4.2
rain_of_fire Soul Shard 17.6 52.7 3.0 3.0 5371.8
soul_fire Mana 6.6 6565.3 1000.0 1182.5 24.3
soul_rot Mana 5.3 1315.3 250.0 249.6 80.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.5
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.4

Statistics & Data Analysis

Fight Length
NightFae_Koraylon Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
NightFae_Koraylon Damage Per Second
Count 520
Mean 9924.80
Minimum 9427.08
Maximum 10521.01
Spread ( max - min ) 1093.93
Range [ ( max - min ) / 2 * 100% ] 5.51%
Standard Deviation 220.1488
5th Percentile 9593.73
95th Percentile 10305.92
( 95th Percentile - 5th Percentile ) 712.19
Mean Distribution
Standard Deviation 9.6542
95.00% Confidence Interval ( 9905.88 - 9943.72 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1891
0.1 Scale Factor Error with Delta=300 414
0.05 Scale Factor Error with Delta=300 1655
0.01 Scale Factor Error with Delta=300 41373
Priority Target DPS
NightFae_Koraylon Priority Target Damage Per Second
Count 520
Mean 5323.70
Minimum 4933.23
Maximum 5763.51
Spread ( max - min ) 830.28
Range [ ( max - min ) / 2 * 100% ] 7.80%
Standard Deviation 133.1345
5th Percentile 5124.18
95th Percentile 5568.46
( 95th Percentile - 5th Percentile ) 444.27
Mean Distribution
Standard Deviation 5.8383
95.00% Confidence Interval ( 5312.26 - 5335.14 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2403
0.1 Scale Factor Error with Delta=300 152
0.05 Scale Factor Error with Delta=300 606
0.01 Scale Factor Error with Delta=300 15131
DPS(e)
NightFae_Koraylon Damage Per Second (Effective)
Count 520
Mean 9924.80
Minimum 9427.08
Maximum 10521.01
Spread ( max - min ) 1093.93
Range [ ( max - min ) / 2 * 100% ] 5.51%
Damage
NightFae_Koraylon Damage
Count 520
Mean 2603675.41
Minimum 2101409.73
Maximum 3165670.12
Spread ( max - min ) 1064260.39
Range [ ( max - min ) / 2 * 100% ] 20.44%
DTPS
NightFae_Koraylon Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_KoraylonTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.26 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.74 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.32 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.30 soul_rot
F 12.07 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.97 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.63 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.23 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.13 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.97 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.76 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.37 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.79 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.65 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.00 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLJFINQRRNOPGJLKFJLKAELLINQQPNQFGLGGKLLJA9INQNQRRNFGGGJLKLLEAJINQRRNPRFJ9GKJLKLLAIQNQRRPNFJLGKLLMDEGKAIOQNQRDFGGDGKLKLJLLAINQRRNQPFGK9GJELKJLAINQRRRNPFGJLGKLLJLKLAIQONPQNFJLGLEKGGJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E soul_rot Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.747 aoe F channel_demonfire Fluffy_Pillow 49623.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:05.052 cds M summon_infernal Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:06.059 aoe I havoc enemy2 49503.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:07.067 havoc Q chaos_bolt Fluffy_Pillow 49007.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:09.077 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.083 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.7/5: 94% soul_shard
bloodlust, backdraft, soul_rot
0:11.488 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:12.496 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.503 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft
0:14.910 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.917 havoc Q chaos_bolt Fluffy_Pillow 49959.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.323 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:18.330 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.339 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:21.753 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:22.759 aoe G immolate enemy2 49252.0/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:23.766 aoe G immolate enemy3 49005.5/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:24.774 aoe D rain_of_fire Fluffy_Pillow 48759.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:25.780 aoe L incinerate Fluffy_Pillow 49262.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:26.719 aoe K conflagrate Fluffy_Pillow 48732.0/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:27.723 aoe L incinerate Fluffy_Pillow 48734.0/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:28.664 aoe L incinerate Fluffy_Pillow 48204.5/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust
0:30.005 aoe D rain_of_fire Fluffy_Pillow 47875.0/50000: 96% mana
3.2/5: 64% soul_shard
bloodlust
0:31.013 aoe K conflagrate Fluffy_Pillow 48379.0/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust
0:32.019 default A cataclysm Fluffy_Pillow 48382.0/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:33.360 aoe L incinerate Fluffy_Pillow 48552.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:34.300 aoe L incinerate Fluffy_Pillow 48022.5/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:35.640 aoe J rain_of_fire Fluffy_Pillow 47692.5/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust
0:36.644 aoe F channel_demonfire Fluffy_Pillow 48194.5/50000: 96% mana
0.3/5: 6% soul_shard
bloodlust
0:38.831 aoe I havoc enemy2 48538.0/50000: 97% mana
0.8/5: 16% soul_shard
bloodlust
0:39.838 havoc N conflagrate Fluffy_Pillow 48041.5/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:40.845 havoc Q chaos_bolt Fluffy_Pillow 48045.0/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust, backdraft
0:42.251 havoc R incinerate Fluffy_Pillow 48748.0/50000: 97% mana
0.4/5: 8% soul_shard
0:43.992 havoc R incinerate Fluffy_Pillow 48618.5/50000: 97% mana
0.9/5: 18% soul_shard
0:45.734 havoc N conflagrate Fluffy_Pillow 48489.5/50000: 97% mana
1.6/5: 32% soul_shard
0:47.042 havoc O soul_fire Fluffy_Pillow 48643.5/50000: 97% mana
2.8/5: 56% soul_shard
backdraft
0:50.521 havoc P immolate Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.828 aoe G immolate enemy3 48906.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:53.135 aoe J rain_of_fire Fluffy_Pillow 48810.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:54.441 aoe L incinerate Fluffy_Pillow 49463.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
0:55.660 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:56.967 aoe F channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
0:59.896 aoe J rain_of_fire Fluffy_Pillow 49870.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:01.204 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:02.425 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
1:03.732 default A cataclysm Fluffy_Pillow 49156.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
1:05.473 aoe E soul_rot Fluffy_Pillow 49502.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
1:06.778 aoe L incinerate Fluffy_Pillow 49751.5/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, soul_rot
1:07.997 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot
1:09.737 aoe I havoc enemy2 48872.0/50000: 98% mana
3.1/5: 62% soul_shard
soul_rot
1:11.044 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.3/5: 66% soul_shard
soul_rot
1:12.350 havoc Q chaos_bolt Fluffy_Pillow 48678.5/50000: 97% mana
4.4/5: 88% soul_shard
backdraft, soul_rot
1:14.177 havoc Q chaos_bolt Fluffy_Pillow 49592.0/50000: 99% mana
2.7/5: 54% soul_shard
soul_rot
1:16.786 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:18.092 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
1:19.398 havoc Q chaos_bolt Fluffy_Pillow 49405.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
1:21.227 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:24.028 aoe G immolate enemy3 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:25.334 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
1:27.074 aoe G immolate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
1:28.380 aoe G immolate enemy2 48905.0/50000: 98% mana
1.7/5: 34% soul_shard
1:29.687 aoe K conflagrate Fluffy_Pillow 48808.5/50000: 98% mana
1.8/5: 36% soul_shard
1:30.993 aoe L incinerate Fluffy_Pillow 48961.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:32.213 aoe L incinerate Fluffy_Pillow 48571.5/50000: 97% mana
2.8/5: 56% soul_shard
1:33.955 aoe J rain_of_fire Fluffy_Pillow 48442.5/50000: 97% mana
3.3/5: 66% soul_shard
1:35.261 default A cataclysm Fluffy_Pillow 49095.5/50000: 98% mana
0.5/5: 10% soul_shard
1:37.209 default 9 soul_fire Fluffy_Pillow 49502.5/50000: 99% mana
0.8/5: 16% soul_shard
1:40.687 aoe I havoc enemy2 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:41.993 havoc N conflagrate Fluffy_Pillow 48655.5/50000: 97% mana
2.4/5: 48% soul_shard
1:43.300 havoc Q chaos_bolt Fluffy_Pillow 48809.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
1:45.127 havoc N conflagrate Fluffy_Pillow 49722.5/50000: 99% mana
1.7/5: 34% soul_shard
1:46.434 havoc Q chaos_bolt Fluffy_Pillow 49876.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:48.260 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
1:50.002 havoc R incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.9/5: 38% soul_shard
1:51.742 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
2.5/5: 50% soul_shard
1:53.243 aoe F channel_demonfire Fluffy_Pillow 49123.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
1:56.025 aoe G immolate enemy2 49764.5/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
1:57.331 aoe G immolate Fluffy_Pillow 49252.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
1:58.637 aoe G immolate enemy3 49155.0/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
1:59.943 aoe J rain_of_fire Fluffy_Pillow 49058.0/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
2:01.250 aoe L incinerate Fluffy_Pillow 49711.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
2:02.469 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
2:03.775 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:04.994 aoe L incinerate Fluffy_Pillow 48764.5/50000: 98% mana
2.9/5: 58% soul_shard
2:06.732 aoe E soul_rot Fluffy_Pillow 48633.5/50000: 97% mana
3.5/5: 70% soul_shard
2:08.080 default A cataclysm Fluffy_Pillow 49057.5/50000: 98% mana
3.6/5: 72% soul_shard
soul_rot
2:09.819 aoe J rain_of_fire Fluffy_Pillow 49427.0/50000: 99% mana
3.8/5: 76% soul_shard
soul_rot
2:11.127 aoe I havoc enemy2 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
soul_rot
2:12.432 havoc N conflagrate Fluffy_Pillow 49652.5/50000: 99% mana
1.1/5: 22% soul_shard
soul_rot
2:13.739 havoc Q chaos_bolt Fluffy_Pillow 49806.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft, soul_rot
2:15.566 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
soul_rot
2:17.307 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:19.049 havoc N conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
1.6/5: 32% soul_shard
2:20.357 havoc P immolate Fluffy_Pillow 49027.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:21.661 havoc R incinerate Fluffy_Pillow 48929.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:22.880 aoe F channel_demonfire Fluffy_Pillow 48539.0/50000: 97% mana
3.7/5: 74% soul_shard
2:25.707 aoe J rain_of_fire Fluffy_Pillow 49202.5/50000: 98% mana
4.0/5: 80% soul_shard
2:27.014 default 9 soul_fire Fluffy_Pillow 49856.0/50000: 100% mana
1.2/5: 24% soul_shard
2:30.492 aoe G immolate enemy3 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
2:31.798 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.7/5: 54% soul_shard
2:33.104 aoe J rain_of_fire Fluffy_Pillow 49058.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
2:34.411 aoe L incinerate Fluffy_Pillow 49712.0/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
2:35.632 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
0.9/5: 18% soul_shard
2:36.937 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:38.157 aoe L incinerate Fluffy_Pillow 48765.5/50000: 98% mana
1.9/5: 38% soul_shard
2:39.897 default A cataclysm Fluffy_Pillow 48635.5/50000: 97% mana
2.2/5: 44% soul_shard
2:41.637 aoe I havoc enemy2 49005.5/50000: 98% mana
2.5/5: 50% soul_shard
2:42.944 havoc Q chaos_bolt Fluffy_Pillow 48659.0/50000: 97% mana
2.8/5: 56% soul_shard
2:45.553 havoc N conflagrate Fluffy_Pillow 49963.5/50000: 100% mana
1.1/5: 22% soul_shard
2:46.861 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
2:48.689 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:50.428 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
2:52.169 havoc P immolate Fluffy_Pillow 48872.0/50000: 98% mana
1.8/5: 36% soul_shard
2:53.475 havoc N conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
2.1/5: 42% soul_shard
2:54.781 aoe F channel_demonfire Fluffy_Pillow 48928.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
2:57.616 aoe J rain_of_fire Fluffy_Pillow 49595.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
2:58.922 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
3:00.143 aoe G immolate enemy3 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
3:01.450 aoe K conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
1.4/5: 28% soul_shard
3:02.757 aoe L incinerate Fluffy_Pillow 49060.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
3:03.975 aoe L incinerate Fluffy_Pillow 48669.0/50000: 97% mana
2.6/5: 52% soul_shard
3:05.715 cds M summon_infernal Fluffy_Pillow 48539.0/50000: 97% mana
2.8/5: 56% soul_shard
3:07.018 aoe D rain_of_fire Fluffy_Pillow 48190.5/50000: 96% mana
3.3/5: 66% soul_shard
3:08.325 aoe E soul_rot Fluffy_Pillow 48844.0/50000: 98% mana
0.7/5: 14% soul_shard
3:09.631 aoe G immolate enemy2 49247.0/50000: 98% mana
1.3/5: 26% soul_shard
soul_rot
3:10.938 aoe K conflagrate Fluffy_Pillow 49150.5/50000: 98% mana
1.6/5: 32% soul_shard
soul_rot
3:12.245 default A cataclysm Fluffy_Pillow 49304.0/50000: 99% mana
2.7/5: 54% soul_shard
backdraft, soul_rot
3:13.986 aoe I havoc enemy2 49502.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, soul_rot
3:15.291 havoc O soul_fire Fluffy_Pillow 49155.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, soul_rot
3:18.964 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:20.791 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
3.0/5: 60% soul_shard
3:22.096 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:23.925 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:25.666 aoe D rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
3:26.973 aoe F channel_demonfire Fluffy_Pillow 49656.0/50000: 99% mana
1.4/5: 28% soul_shard
3:29.746 aoe G immolate enemy2 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
3:31.051 aoe G immolate Fluffy_Pillow 49251.5/50000: 99% mana
2.8/5: 56% soul_shard
3:32.358 aoe D rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
3.3/5: 66% soul_shard
3:33.664 aoe G immolate enemy3 49808.0/50000: 100% mana
0.6/5: 12% soul_shard
3:34.970 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
3:36.276 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
3:37.495 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
3:38.802 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:40.022 aoe J rain_of_fire Fluffy_Pillow 48765.5/50000: 98% mana
3.2/5: 64% soul_shard
3:41.327 aoe L incinerate Fluffy_Pillow 49418.0/50000: 99% mana
0.5/5: 10% soul_shard
3:43.068 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
3:44.807 default A cataclysm Fluffy_Pillow 48872.0/50000: 98% mana
1.3/5: 26% soul_shard
3:46.547 aoe I havoc enemy2 49242.0/50000: 98% mana
1.6/5: 32% soul_shard
3:47.855 havoc N conflagrate Fluffy_Pillow 48896.0/50000: 98% mana
1.8/5: 36% soul_shard
3:49.161 havoc Q chaos_bolt Fluffy_Pillow 49049.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:50.990 havoc R incinerate Fluffy_Pillow 49963.5/50000: 100% mana
1.2/5: 24% soul_shard
3:52.731 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
3:54.473 havoc N conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
2.4/5: 48% soul_shard
3:55.779 havoc Q chaos_bolt Fluffy_Pillow 49026.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
3:57.607 havoc P immolate Fluffy_Pillow 49940.5/50000: 100% mana
1.8/5: 36% soul_shard
3:58.913 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
4:01.726 aoe G immolate enemy2 49908.5/50000: 100% mana
2.4/5: 48% soul_shard
4:03.034 aoe K conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
2.4/5: 48% soul_shard
4:04.341 default 9 soul_fire Fluffy_Pillow 49406.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
4:07.818 aoe G immolate enemy3 49002.0/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
4:09.124 aoe J rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
4:10.430 aoe E soul_rot Fluffy_Pillow 49558.0/50000: 99% mana
1.8/5: 36% soul_shard
backdraft
4:11.734 aoe L incinerate Fluffy_Pillow 49751.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft, soul_rot
4:12.953 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
soul_rot
4:14.260 aoe J rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, soul_rot
4:15.567 aoe L incinerate Fluffy_Pillow 49809.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft, soul_rot
4:16.786 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
soul_rot
4:18.525 aoe I havoc enemy2 49371.5/50000: 99% mana
0.7/5: 14% soul_shard
soul_rot
4:19.830 havoc N conflagrate Fluffy_Pillow 49024.0/50000: 98% mana
1.0/5: 20% soul_shard
4:21.136 havoc Q chaos_bolt Fluffy_Pillow 49177.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
4:22.965 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
4:24.707 havoc R incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
4:26.446 havoc R incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.5/5: 30% soul_shard
4:28.187 havoc N conflagrate Fluffy_Pillow 48743.0/50000: 97% mana
2.3/5: 46% soul_shard
4:29.493 havoc P immolate Fluffy_Pillow 48896.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:30.797 aoe F channel_demonfire Fluffy_Pillow 48798.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
4:33.670 aoe G immolate enemy2 49484.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
4:34.978 aoe J rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
4.4/5: 88% soul_shard
backdraft
4:36.283 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
1.4/5: 28% soul_shard
backdraft
4:37.503 aoe G immolate enemy3 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
4:38.808 aoe K conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
1.9/5: 38% soul_shard
4:40.117 aoe L incinerate Fluffy_Pillow 49059.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:41.337 aoe L incinerate Fluffy_Pillow 48669.5/50000: 97% mana
2.9/5: 58% soul_shard
4:43.077 aoe J rain_of_fire Fluffy_Pillow 48539.5/50000: 97% mana
3.4/5: 68% soul_shard
4:44.384 aoe L incinerate Fluffy_Pillow 49193.0/50000: 98% mana
0.4/5: 8% soul_shard
4:46.127 aoe K conflagrate Fluffy_Pillow 49003.5/50000: 98% mana
0.9/5: 18% soul_shard
4:47.433 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
4:48.653 default A cataclysm Fluffy_Pillow 48766.5/50000: 98% mana
2.1/5: 42% soul_shard
4:50.394 aoe I havoc enemy2 49137.0/50000: 98% mana
2.3/5: 46% soul_shard
4:51.701 havoc Q chaos_bolt Fluffy_Pillow 48790.5/50000: 98% mana
2.4/5: 48% soul_shard
4:54.309 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:57.787 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
4:59.093 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
5:00.399 havoc Q chaos_bolt Fluffy_Pillow 49058.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
5:02.226 havoc N conflagrate Fluffy_Pillow 49972.0/50000: 100% mana
2.8/5: 56% soul_shard
5:03.533 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
backdraft
5:06.465 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
5:07.770 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
backdraft
5:08.990 aoe G immolate enemy3 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
5:10.298 aoe L incinerate Fluffy_Pillow 48906.5/50000: 98% mana
2.0/5: 40% soul_shard
5:12.038 aoe E soul_rot Fluffy_Pillow 48776.5/50000: 98% mana
2.6/5: 52% soul_shard
5:13.345 aoe K conflagrate Fluffy_Pillow 49180.0/50000: 98% mana
2.6/5: 52% soul_shard
soul_rot
5:14.651 aoe G immolate Fluffy_Pillow 49333.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft, soul_rot
5:15.957 aoe G immolate enemy2 49236.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, soul_rot
5:17.263 aoe J rain_of_fire Fluffy_Pillow 49139.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft, soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Koraylon"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=325066/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Niya : 10031 dps, 5406 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10031.1 10031.1 19.1 / 0.191% 845.2 / 8.4% 22.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
389.2 386.5 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 10031
Cataclysm 801 8.0% 9.7 32.25sec 24780 14584 Direct 29.1 6882 13803 8260 19.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 29.06 0.00 0.00 1.6992 0.0000 240036.19 240036.19 0.00% 14583.89 14583.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.09% 23.27 15 33 6881.72 6141 8157 6881.59 6602 7157 160186 160186 0.00%
crit 19.91% 5.78 0 13 13802.63 12283 16095 13746.35 0 15608 79850 79850 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.76
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1063) 0.0% (10.6%) 12.0 25.82sec 26543 9865

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.99 0.00 179.03 0.00 2.6907 0.1634 0.00 0.00 0.00% 9865.10 9865.10

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:11.99
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1063 10.6% 0.0 0.00sec 0 0 Direct 537.1 497 996 593 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 537.09 0.00 0.00 0.0000 0.0000 318366.49 318366.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 433.52 320 559 496.53 263 1101 496.77 470 522 215251 215251 0.00%
crit 19.28% 103.56 66 147 996.07 525 2201 996.48 888 1136 103115 103115 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1353 (1818) 13.5% (18.1%) 21.5 13.73sec 25245 12888 Direct 42.9 (85.4) 0 9444 9444 100.0% (59.5%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.53 42.86 0.00 0.00 1.9589 0.0000 404748.49 404748.49 0.00% 12887.69 12887.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.86 32 56 9444.21 5876 13700 9443.63 9167 9713 404748 404748 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.63
  • if_expr:cast_time<havoc_remains
    Internal Combustion 465 4.6% 42.6 13.74sec 3264 0 Direct 42.6 2746 5499 3264 18.8%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.56 42.56 0.00 0.00 0.0000 0.0000 138893.09 138893.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.19% 34.55 22 49 2745.79 1 4151 2749.49 2558 2991 94900 94900 0.00%
crit 18.81% 8.00 2 17 5499.19 404 8136 5506.03 3613 6716 43993 43993 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 843 8.4% 36.9 7.93sec 6837 5467 Direct 56.6 3738 7475 4457 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.91 56.61 0.00 0.00 1.2508 0.0000 252336.57 252336.57 0.00% 5466.56 5466.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 45.72 32 60 3737.89 2047 5620 3738.77 3539 3985 170913 170913 0.00%
crit 19.24% 10.89 3 19 7475.03 4099 11117 7471.01 5734 9461 81423 81423 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.20
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.70
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1672 16.7% 26.6 10.90sec 18804 14907 Direct 33.8 1600 3192 1902 18.9%
Periodic 347.0 1056 2112 1259 19.2% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.64 33.78 347.00 347.00 1.2614 2.4834 500978.44 500978.44 0.00% 559.54 14906.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.13% 27.41 16 38 1600.37 825 2253 1601.45 1472 1731 43862 43862 0.00%
crit 18.87% 6.37 0 15 3191.57 1639 4494 3179.23 0 3917 20336 20336 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 280.34 217 349 1055.91 1 1421 1055.99 1039 1076 296022 296022 0.00%
crit 19.21% 66.66 35 99 2111.82 7 2829 2111.84 1993 2206 140759 140759 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:18.03
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.72
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 642 6.4% 44.8 6.06sec 4293 2931 Direct 55.6 (55.6) 2900 5811 3462 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.84 55.60 0.00 0.00 1.4648 0.0000 192500.01 192500.01 0.00% 2930.97 2930.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 44.87 26 64 2900.35 1336 3832 2903.17 2699 3163 130156 130156 0.00%
crit 19.30% 10.73 2 22 5811.29 2662 7639 5817.43 4552 7093 62344 62344 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.90
    havoc
    [R]:11.21
  • if_expr:cast_time<havoc_remains
Rain of Fire 959 9.6% 17.6 15.75sec 16313 13082 Periodic 417.1 576 1152 688 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.59 0.00 0.00 417.08 1.2470 0.0000 286956.37 286956.37 0.00% 13082.12 13082.12
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.56% 336.02 206 461 576.00 507 679 576.03 565 587 193564 193564 0.00%
crit 19.44% 81.06 48 117 1151.91 1013 1348 1152.13 1125 1182 93392 93392 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.34
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.24
Soul Fire 523 5.2% 5.6 49.32sec 28157 8097 Direct 7.9 16790 33415 19912 18.7%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.86 0.00 0.00 3.4775 0.0000 156381.02 156381.02 0.00% 8097.19 8097.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.25% 6.38 2 11 16790.19 8612 23429 16840.45 13542 20583 107168 107168 0.00%
crit 18.75% 1.47 0 5 33414.69 17239 46462 27138.06 0 46462 49213 49213 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.26
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.36
  • if_expr:cast_time<havoc_remains
Soul Rot 340 3.4% 5.3 62.49sec 19297 15442 Periodic 96.7 882 1771 1053 19.3% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.28 0.00 96.70 96.70 1.2497 1.2893 101904.11 101904.11 0.00% 776.26 15442.36
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 78.06 52 101 882.20 424 1395 882.22 828 939 68851 68851 0.00%
crit 19.28% 18.64 8 33 1771.34 849 2790 1771.98 1341 2233 33053 33053 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.29
Summon Infernal 82 0.8% 2.0 180.39sec 12076 10446 Direct 6.0 3348 6696 4025 20.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1564 0.0000 24151.64 24151.64 0.00% 10446.21 10446.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.78% 4.79 2 6 3348.13 3348 3348 3348.13 3348 3348 16026 16026 0.00%
crit 20.22% 1.21 0 4 6696.27 6696 6696 5009.33 0 6696 8126 8126 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3820 / 774
Immolation 3553 7.1% 39.0 5.49sec 5466 0 Direct 117.0 1529 3056 1823 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213187.48 213187.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 94.57 83 107 1529.47 1395 2023 1529.45 1497 1571 144644 144644 0.00%
crit 19.17% 22.43 10 34 3056.09 2790 4046 3054.54 2816 3371 68543 68543 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.5% 41.0 5.25sec 390 271 Direct 41.0 326 651 390 19.8%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15990.25 22840.47 29.99% 271.47 271.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.20% 32.88 23 40 325.55 326 326 325.55 326 326 10705 15291 29.99%
crit 19.80% 8.12 1 18 651.10 651 651 651.10 651 651 5285 7549 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.1% 93.2 3.21sec 1649 1133 Direct 92.5 1395 2790 1662 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 153705.69 153705.69 0.00% 1132.58 1132.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 74.82 53 100 1395.06 1395 1395 1395.06 1395 1395 104374 104374 0.00%
crit 19.11% 17.68 5 31 2790.11 2790 2790 2790.11 2790 2790 49331 49331 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
NightFae_Niya
Havoc 9.6 31.94sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.64 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.64
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.9 0.0 8.0sec 8.0sec 4.1sec 50.48% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.2s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.48%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Redirected Anima 16.1 0.0 48.1sec 18.7sec 59.6sec 84.82% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.1s / 282.9s
  • trigger_min/max:0.1s / 64.2s
  • trigger_pct:98.94%
  • duration_min/max:0.2s / 306.1s

Stack Uptimes

  • redirected_anima_1:20.43%
  • redirected_anima_2:10.26%
  • redirected_anima_3:3.15%
  • redirected_anima_4:0.60%
  • redirected_anima_5:0.07%
  • redirected_anima_6:0.00%
  • redirected_anima_8:17.09%
  • redirected_anima_9:20.37%
  • redirected_anima_10:9.24%
  • redirected_anima_11:2.87%
  • redirected_anima_12:0.72%
  • redirected_anima_13:0.12%
  • redirected_anima_14:0.20%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.91% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.1s
  • trigger_min/max:61.3s / 68.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • soul_rot_1:13.91%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.1s
  • trigger_min/max:180.0s / 185.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.1s
  • trigger_min/max:180.0s / 185.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.19% 11.09% 17.10% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
soul_fire Soul Shard 6.57 7.15 7.52% 1.09 0.77 9.74%
immolate Soul Shard 346.97 33.58 35.31% 0.10 1.12 3.22%
incinerate Soul Shard 44.86 11.19 11.77% 0.25 0.01 0.07%
conflagrate Soul Shard 36.90 28.30 29.76% 0.77 0.00 0.00%
mana_regen Mana 659.06 115836.08 100.00% 175.76 33721.56 22.55%
immolate_crits Soul Shard 33.00 3.19 3.35% 0.10 0.11 3.36%
incinerate_crits Soul Shard 10.74 1.07 1.13% 0.10 0.00 0.09%
infernal Soul Shard 120.00 10.61 11.16% 0.09 1.39 11.56%
pet - imp
energy_regen Energy 360.75 3557.55 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.47 389.17 33737.8 49188.8 47897.5 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Niya
cataclysm Mana 9.7 4847.9 500.0 500.5 49.5
channel_demonfire Mana 12.0 8988.8 750.0 749.4 35.4
chaos_bolt Soul Shard 21.5 43.0 2.0 2.0 12630.8
conflagrate Mana 36.9 18448.7 500.0 499.9 13.7
havoc Mana 9.6 9641.8 1000.0 1000.5 0.0
immolate Mana 26.6 19968.8 750.0 749.5 25.1
incinerate Mana 44.9 44863.8 1000.0 1000.6 4.3
rain_of_fire Soul Shard 17.6 52.8 3.0 3.0 5439.2
soul_fire Mana 6.6 6567.2 1000.0 1182.5 23.8
soul_rot Mana 5.3 1318.1 250.0 249.6 77.3
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
NightFae_Niya Damage Per Second
Count 520
Mean 10031.07
Minimum 9488.10
Maximum 10785.01
Spread ( max - min ) 1296.91
Range [ ( max - min ) / 2 * 100% ] 6.46%
Standard Deviation 222.6277
5th Percentile 9697.15
95th Percentile 10398.30
( 95th Percentile - 5th Percentile ) 701.15
Mean Distribution
Standard Deviation 9.7629
95.00% Confidence Interval ( 10011.94 - 10050.21 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1893
0.1 Scale Factor Error with Delta=300 424
0.05 Scale Factor Error with Delta=300 1693
0.01 Scale Factor Error with Delta=300 42310
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 520
Mean 5405.85
Minimum 5026.54
Maximum 5880.59
Spread ( max - min ) 854.05
Range [ ( max - min ) / 2 * 100% ] 7.90%
Standard Deviation 129.7605
5th Percentile 5210.13
95th Percentile 5632.21
( 95th Percentile - 5th Percentile ) 422.08
Mean Distribution
Standard Deviation 5.6904
95.00% Confidence Interval ( 5394.69 - 5417.00 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2214
0.1 Scale Factor Error with Delta=300 144
0.05 Scale Factor Error with Delta=300 575
0.01 Scale Factor Error with Delta=300 14374
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 520
Mean 10031.07
Minimum 9488.10
Maximum 10785.01
Spread ( max - min ) 1296.91
Range [ ( max - min ) / 2 * 100% ] 6.46%
Damage
NightFae_Niya Damage
Count 520
Mean 2617252.43
Minimum 2076459.40
Maximum 3155369.81
Spread ( max - min ) 1078910.41
Range [ ( max - min ) / 2 * 100% ] 20.61%
DTPS
NightFae_Niya Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.26 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.76 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.34 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.29 soul_rot
F 11.99 channel_demonfire,if=dot.immolate.remains>cast_time
G 18.03 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.64 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.24 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.20 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.90 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.70 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.36 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.72 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.63 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.21 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGDGLKLLDKALLJFINQRRNOPGJLKFJLKAELLINQQPRNFGJLKLLLLA9IQNQNQPNFGJLKLLLJAEIRNQRNPRFJ9GKJLKLLAIQRNQRPNFJLGKLLMDGKEAIOQNQRDFGGDGKLKLJLLAINQRRNQPFGK9GJLKEJLAIRNQRRNPFGJLGKLLJLKLAIRNOQRFJKLLGKJEGG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.747 aoe F channel_demonfire Fluffy_Pillow 49623.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.991 cds M summon_infernal Fluffy_Pillow 49995.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:05.997 aoe I havoc enemy2 49498.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:07.004 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:09.013 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:10.020 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot, redirected_anima(8)
0:11.427 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima(8)
0:12.434 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:13.441 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:14.847 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, redirected_anima(8)
0:15.854 havoc Q chaos_bolt Fluffy_Pillow 49959.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:17.262 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, redirected_anima(9)
0:18.267 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:19.275 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:21.801 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:22.806 aoe G immolate enemy2 49251.5/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:23.812 aoe D rain_of_fire Fluffy_Pillow 49004.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:24.821 aoe G immolate enemy3 49509.0/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:25.827 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:26.764 aoe K conflagrate Fluffy_Pillow 48720.5/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust, redirected_anima(9)
0:27.771 aoe L incinerate Fluffy_Pillow 48724.0/50000: 97% mana
2.1/5: 42% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:28.709 aoe L incinerate Fluffy_Pillow 48193.0/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima(9)
0:30.050 aoe D rain_of_fire Fluffy_Pillow 47863.5/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust, redirected_anima(9)
0:31.056 aoe K conflagrate Fluffy_Pillow 48366.5/50000: 97% mana
0.8/5: 16% soul_shard
bloodlust, redirected_anima(9)
0:32.062 default A cataclysm Fluffy_Pillow 48369.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:33.399 aoe L incinerate Fluffy_Pillow 48538.0/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft, redirected_anima
0:34.339 aoe L incinerate Fluffy_Pillow 48008.0/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima
0:35.678 aoe J rain_of_fire Fluffy_Pillow 47677.5/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust, redirected_anima
0:36.686 aoe F channel_demonfire Fluffy_Pillow 48181.5/50000: 96% mana
0.4/5: 8% soul_shard
bloodlust, redirected_anima
0:38.961 aoe I havoc enemy2 48569.0/50000: 97% mana
0.8/5: 16% soul_shard
bloodlust, redirected_anima
0:39.965 havoc N conflagrate Fluffy_Pillow 48071.0/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust, redirected_anima
0:40.971 havoc Q chaos_bolt Fluffy_Pillow 48074.0/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust, backdraft, redirected_anima
0:42.377 havoc R incinerate Fluffy_Pillow 48777.0/50000: 98% mana
0.5/5: 10% soul_shard
redirected_anima
0:44.118 havoc R incinerate Fluffy_Pillow 48647.5/50000: 97% mana
0.9/5: 18% soul_shard
redirected_anima
0:45.858 havoc N conflagrate Fluffy_Pillow 48517.5/50000: 97% mana
1.9/5: 38% soul_shard
0:47.165 havoc O soul_fire Fluffy_Pillow 48671.0/50000: 97% mana
3.2/5: 64% soul_shard
backdraft
0:50.643 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima
0:51.947 aoe G immolate enemy3 48904.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima
0:53.254 aoe J rain_of_fire Fluffy_Pillow 48808.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima
0:54.563 aoe L incinerate Fluffy_Pillow 49462.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, redirected_anima
0:55.783 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
redirected_anima
0:57.090 aoe F channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, redirected_anima
0:59.967 aoe J rain_of_fire Fluffy_Pillow 49844.5/50000: 100% mana
3.5/5: 70% soul_shard
backdraft, redirected_anima(2)
1:01.272 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, redirected_anima(2)
1:02.491 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
redirected_anima(2)
1:03.797 default A cataclysm Fluffy_Pillow 49155.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, redirected_anima(2)
1:05.537 aoe E soul_rot Fluffy_Pillow 49502.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, redirected_anima(2)
1:06.843 aoe L incinerate Fluffy_Pillow 49752.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft, soul_rot, redirected_anima(2)
1:08.063 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
soul_rot, redirected_anima(10)
1:09.803 aoe I havoc enemy2 48872.5/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot, redirected_anima(10)
1:11.110 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
3.2/5: 64% soul_shard
soul_rot, redirected_anima(10)
1:12.417 havoc Q chaos_bolt Fluffy_Pillow 48679.5/50000: 97% mana
4.2/5: 84% soul_shard
backdraft, soul_rot, redirected_anima(10)
1:14.242 havoc Q chaos_bolt Fluffy_Pillow 49592.0/50000: 99% mana
2.5/5: 50% soul_shard
soul_rot, redirected_anima(10)
1:16.853 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
redirected_anima(10)
1:18.160 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
redirected_anima(10)
1:19.899 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.5/5: 30% soul_shard
redirected_anima(9)
1:21.205 aoe F channel_demonfire Fluffy_Pillow 49154.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, redirected_anima(9)
1:23.988 aoe G immolate enemy3 49796.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, redirected_anima(9)
1:25.295 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, redirected_anima(9)
1:26.602 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, redirected_anima(9)
1:27.821 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
redirected_anima(9)
1:29.127 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft, redirected_anima(8)
1:30.346 aoe L incinerate Fluffy_Pillow 48764.5/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima(8)
1:32.087 aoe L incinerate Fluffy_Pillow 48635.0/50000: 97% mana
2.2/5: 44% soul_shard
redirected_anima(8)
1:33.828 aoe L incinerate Fluffy_Pillow 48505.5/50000: 97% mana
2.5/5: 50% soul_shard
redirected_anima(8)
1:35.568 default A cataclysm Fluffy_Pillow 48375.5/50000: 97% mana
2.9/5: 58% soul_shard
redirected_anima(8)
1:37.308 default 9 soul_fire Fluffy_Pillow 48745.5/50000: 97% mana
3.3/5: 66% soul_shard
1:40.786 aoe I havoc enemy2 49002.5/50000: 98% mana
4.7/5: 94% soul_shard
1:42.091 havoc Q chaos_bolt Fluffy_Pillow 48655.0/50000: 97% mana
4.8/5: 96% soul_shard
1:44.702 havoc N conflagrate Fluffy_Pillow 49960.5/50000: 100% mana
3.0/5: 60% soul_shard
1:46.007 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
1:47.834 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
1:49.140 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:50.967 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:52.274 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.9/5: 38% soul_shard
1:53.580 aoe F channel_demonfire Fluffy_Pillow 49405.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:56.437 aoe G immolate enemy3 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:57.743 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
1:59.051 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
2:00.270 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
2:01.809 aoe L incinerate Fluffy_Pillow 49271.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
2:03.028 aoe L incinerate Fluffy_Pillow 48881.0/50000: 98% mana
2.1/5: 42% soul_shard
2:04.769 aoe L incinerate Fluffy_Pillow 48751.5/50000: 98% mana
2.5/5: 50% soul_shard
2:06.510 aoe J rain_of_fire Fluffy_Pillow 48622.0/50000: 97% mana
3.0/5: 60% soul_shard
2:07.816 default A cataclysm Fluffy_Pillow 49275.0/50000: 99% mana
0.0/5: 0% soul_shard
2:09.556 aoe E soul_rot Fluffy_Pillow 49502.0/50000: 99% mana
0.6/5: 12% soul_shard
2:10.860 aoe I havoc enemy2 49751.0/50000: 100% mana
0.7/5: 14% soul_shard
soul_rot, redirected_anima
2:12.165 havoc R incinerate Fluffy_Pillow 49403.5/50000: 99% mana
0.9/5: 18% soul_shard
soul_rot, redirected_anima(9)
2:13.903 havoc N conflagrate Fluffy_Pillow 49001.0/50000: 98% mana
1.5/5: 30% soul_shard
soul_rot, redirected_anima(9)
2:15.210 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, soul_rot, redirected_anima(9)
2:17.037 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
soul_rot, redirected_anima(9)
2:18.777 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
soul_rot, redirected_anima(9)
2:20.083 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(9)
2:21.388 havoc R incinerate Fluffy_Pillow 49057.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima(9)
2:22.607 aoe F channel_demonfire Fluffy_Pillow 48667.0/50000: 97% mana
3.6/5: 72% soul_shard
redirected_anima(9)
2:25.501 aoe J rain_of_fire Fluffy_Pillow 49364.0/50000: 99% mana
4.0/5: 80% soul_shard
redirected_anima(9)
2:26.807 default 9 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
redirected_anima(9)
2:30.286 aoe G immolate enemy3 49003.0/50000: 98% mana
2.4/5: 48% soul_shard
redirected_anima(9)
2:31.592 aoe K conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
2.7/5: 54% soul_shard
redirected_anima(9)
2:32.900 aoe J rain_of_fire Fluffy_Pillow 49060.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima(9)
2:34.206 aoe L incinerate Fluffy_Pillow 49713.0/50000: 99% mana
0.5/5: 10% soul_shard
backdraft, redirected_anima(9)
2:35.426 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
redirected_anima(9)
2:36.731 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, redirected_anima(9)
2:37.951 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.8/5: 36% soul_shard
redirected_anima(9)
2:39.693 default A cataclysm Fluffy_Pillow 48636.0/50000: 97% mana
2.3/5: 46% soul_shard
redirected_anima(8)
2:41.434 aoe I havoc enemy2 49006.5/50000: 98% mana
2.5/5: 50% soul_shard
2:42.739 havoc Q chaos_bolt Fluffy_Pillow 48659.0/50000: 97% mana
2.6/5: 52% soul_shard
2:45.349 havoc R incinerate Fluffy_Pillow 49964.0/50000: 100% mana
0.9/5: 18% soul_shard
2:47.090 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
2:48.396 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:50.224 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
2:51.964 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
2:53.271 havoc N conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.9/5: 38% soul_shard
2:54.578 aoe F channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:57.451 aoe J rain_of_fire Fluffy_Pillow 49745.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
2:58.757 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft, redirected_anima
2:59.977 aoe G immolate enemy3 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
redirected_anima(2)
3:01.284 aoe K conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.2/5: 24% soul_shard
redirected_anima(2)
3:02.592 aoe L incinerate Fluffy_Pillow 49060.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft, redirected_anima(2)
3:03.813 aoe L incinerate Fluffy_Pillow 48670.5/50000: 97% mana
2.3/5: 46% soul_shard
redirected_anima(2)
3:05.553 cds M summon_infernal Fluffy_Pillow 48540.5/50000: 97% mana
2.7/5: 54% soul_shard
redirected_anima(2)
3:06.860 aoe D rain_of_fire Fluffy_Pillow 48194.0/50000: 96% mana
3.0/5: 60% soul_shard
redirected_anima(2)
3:08.167 aoe G immolate enemy2 48847.5/50000: 98% mana
0.6/5: 12% soul_shard
redirected_anima(2)
3:09.473 aoe K conflagrate Fluffy_Pillow 48750.5/50000: 98% mana
1.0/5: 20% soul_shard
redirected_anima(2)
3:11.001 aoe E soul_rot Fluffy_Pillow 49014.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft, redirected_anima(2)
3:12.308 default A cataclysm Fluffy_Pillow 49418.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, soul_rot, redirected_anima(2)
3:14.048 aoe I havoc enemy2 49502.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, soul_rot, redirected_anima(10)
3:15.353 havoc O soul_fire Fluffy_Pillow 49154.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, soul_rot, redirected_anima(10)
3:18.832 havoc Q chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, soul_rot, redirected_anima(10)
3:20.659 havoc N conflagrate Fluffy_Pillow 49916.5/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(10)
3:21.966 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, redirected_anima(10)
3:23.794 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(10)
3:25.533 aoe D rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.9/5: 78% soul_shard
redirected_anima(10)
3:26.839 aoe F channel_demonfire Fluffy_Pillow 49654.5/50000: 99% mana
1.3/5: 26% soul_shard
redirected_anima(10)
3:29.619 aoe G immolate enemy2 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
redirected_anima(9)
3:30.925 aoe G immolate Fluffy_Pillow 49252.0/50000: 99% mana
2.7/5: 54% soul_shard
redirected_anima(8)
3:32.232 aoe D rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.1/5: 62% soul_shard
redirected_anima(8)
3:33.539 aoe G immolate enemy3 49809.0/50000: 100% mana
0.5/5: 10% soul_shard
redirected_anima(8)
3:34.846 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
redirected_anima(8)
3:36.155 aoe L incinerate Fluffy_Pillow 49407.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, redirected_anima(8)
3:37.374 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
redirected_anima(8)
3:38.680 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima(8)
3:39.900 aoe J rain_of_fire Fluffy_Pillow 48765.0/50000: 98% mana
3.3/5: 66% soul_shard
redirected_anima(8)
3:41.207 aoe L incinerate Fluffy_Pillow 49418.5/50000: 99% mana
0.5/5: 10% soul_shard
redirected_anima(8)
3:42.946 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
3:44.685 default A cataclysm Fluffy_Pillow 48871.0/50000: 98% mana
1.3/5: 26% soul_shard
3:46.426 aoe I havoc enemy2 49241.5/50000: 98% mana
1.5/5: 30% soul_shard
3:47.733 havoc N conflagrate Fluffy_Pillow 48895.0/50000: 98% mana
1.6/5: 32% soul_shard
3:49.040 havoc Q chaos_bolt Fluffy_Pillow 49048.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:50.866 havoc R incinerate Fluffy_Pillow 49961.5/50000: 100% mana
1.2/5: 24% soul_shard
redirected_anima
3:52.606 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima
3:54.344 havoc N conflagrate Fluffy_Pillow 48871.0/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima
3:55.649 havoc Q chaos_bolt Fluffy_Pillow 49023.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, redirected_anima
3:57.476 havoc P immolate Fluffy_Pillow 49937.0/50000: 100% mana
1.8/5: 36% soul_shard
redirected_anima
3:58.782 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.0/5: 40% soul_shard
redirected_anima(2)
4:01.634 aoe G immolate enemy2 49928.0/50000: 100% mana
2.3/5: 46% soul_shard
redirected_anima(2)
4:02.941 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.4/5: 48% soul_shard
redirected_anima(2)
4:04.247 default 9 soul_fire Fluffy_Pillow 49405.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima(2)
4:07.724 aoe G immolate enemy3 49002.0/50000: 98% mana
4.5/5: 90% soul_shard
backdraft, redirected_anima(2)
4:09.029 aoe J rain_of_fire Fluffy_Pillow 48904.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft, redirected_anima(2)
4:10.334 aoe L incinerate Fluffy_Pillow 49557.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, redirected_anima(2)
4:11.553 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima(2)
4:12.858 aoe E soul_rot Fluffy_Pillow 49154.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, redirected_anima(2)
4:14.165 aoe J rain_of_fire Fluffy_Pillow 49558.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, soul_rot, redirected_anima(2)
4:15.472 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, soul_rot, redirected_anima(10)
4:16.691 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
soul_rot, redirected_anima(10)
4:18.431 aoe I havoc enemy2 49372.0/50000: 99% mana
0.7/5: 14% soul_shard
soul_rot, redirected_anima(10)
4:19.738 havoc R incinerate Fluffy_Pillow 49025.5/50000: 98% mana
0.9/5: 18% soul_shard
soul_rot, redirected_anima(9)
4:21.479 havoc N conflagrate Fluffy_Pillow 48896.0/50000: 98% mana
1.5/5: 30% soul_shard
soul_rot, redirected_anima(9)
4:22.788 havoc Q chaos_bolt Fluffy_Pillow 49050.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, redirected_anima(9)
4:24.616 havoc R incinerate Fluffy_Pillow 49964.5/50000: 100% mana
0.9/5: 18% soul_shard
redirected_anima(9)
4:26.356 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
redirected_anima(9)
4:28.096 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.0/5: 40% soul_shard
redirected_anima(9)
4:29.402 havoc P immolate Fluffy_Pillow 49025.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, redirected_anima(8)
4:30.707 aoe F channel_demonfire Fluffy_Pillow 48927.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, redirected_anima(8)
4:33.578 aoe G immolate enemy2 49613.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft, redirected_anima(8)
4:34.885 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft, redirected_anima(8)
4:36.191 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
1.1/5: 22% soul_shard
backdraft, redirected_anima(8)
4:37.410 aoe G immolate enemy3 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
redirected_anima(8)
4:38.717 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(8)
4:40.022 aoe L incinerate Fluffy_Pillow 49058.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, redirected_anima(8)
4:41.241 aoe L incinerate Fluffy_Pillow 48667.5/50000: 97% mana
2.6/5: 52% soul_shard
redirected_anima(8)
4:42.984 aoe J rain_of_fire Fluffy_Pillow 48539.0/50000: 97% mana
3.1/5: 62% soul_shard
redirected_anima(8)
4:44.289 aoe L incinerate Fluffy_Pillow 49191.5/50000: 98% mana
0.2/5: 4% soul_shard
4:46.030 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
4:47.337 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:48.557 default A cataclysm Fluffy_Pillow 48766.0/50000: 98% mana
1.6/5: 32% soul_shard
4:50.297 aoe I havoc enemy2 49136.0/50000: 98% mana
1.7/5: 34% soul_shard
4:51.603 havoc R incinerate Fluffy_Pillow 48789.0/50000: 98% mana
1.9/5: 38% soul_shard
4:53.345 havoc N conflagrate Fluffy_Pillow 48660.0/50000: 97% mana
2.9/5: 58% soul_shard
4:54.787 havoc O soul_fire Fluffy_Pillow 48881.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
4:58.265 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:00.091 havoc R incinerate Fluffy_Pillow 49915.5/50000: 100% mana
3.0/5: 60% soul_shard
5:01.830 aoe F channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
3.6/5: 72% soul_shard
5:04.651 aoe J rain_of_fire Fluffy_Pillow 49662.0/50000: 99% mana
4.0/5: 80% soul_shard
redirected_anima
5:05.956 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
redirected_anima
5:07.262 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft, redirected_anima
5:08.481 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
redirected_anima
5:10.222 aoe G immolate enemy3 48872.5/50000: 98% mana
2.6/5: 52% soul_shard
redirected_anima
5:11.529 aoe K conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
2.8/5: 56% soul_shard
redirected_anima
5:12.835 aoe J rain_of_fire Fluffy_Pillow 48929.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, redirected_anima
5:14.142 aoe E soul_rot Fluffy_Pillow 49582.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft, redirected_anima
5:15.465 aoe G immolate Fluffy_Pillow 49751.5/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, soul_rot, redirected_anima
5:16.772 aoe G immolate enemy2 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft, soul_rot, redirected_anima(9)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Niya"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=322721/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Nadjia : 9792 dps, 5257 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9791.7 9791.7 18.3 / 0.187% 775.9 / 7.9% 20.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
417.9 414.3 Mana 0.00% 38.9 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 9792
Cataclysm 776 7.9% 9.7 32.37sec 23972 14379 Direct 29.1 6704 13399 7989 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 29.08 0.00 0.00 1.6672 0.0000 232344.32 232344.32 0.00% 14378.63 14378.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 23.48 14 31 6703.80 6142 7261 6703.59 6482 6907 157429 157429 0.00%
crit 19.23% 5.59 0 13 13398.72 12284 14521 13329.47 0 14348 74915 74915 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.76
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1081) 0.0% (11.0%) 12.9 24.07sec 25161 9486

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.86 0.00 192.14 0.00 2.6525 0.1606 0.00 0.00 0.00% 9485.75 9485.75

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.85
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1081 11.0% 0.0 0.00sec 0 0 Direct 576.4 470 943 561 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 576.43 0.00 0.00 0.0000 0.0000 323559.10 323559.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 465.60 328 597 470.45 263 976 470.39 446 499 218983 218983 0.00%
crit 19.23% 110.83 68 155 942.94 525 1952 944.06 817 1056 104576 104576 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1368 (1850) 14.0% (18.9%) 22.8 12.70sec 24307 12513 Direct 45.3 (90.1) 0 9032 9032 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.76 45.30 0.00 0.00 1.9426 0.0000 409093.19 409093.19 0.00% 12512.80 12512.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.30 30 58 9032.31 5871 12240 9031.15 8861 9249 409093 409093 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.89
  • if_expr:cast_time<havoc_remains
    Internal Combustion 482 4.9% 44.8 12.67sec 3219 0 Direct 44.8 2699 5382 3219 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.78 44.78 0.00 0.00 0.0000 0.0000 144122.65 144122.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 36.09 22 52 2698.75 1 3715 2699.34 2448 2879 97386 97386 0.00%
crit 19.41% 8.69 2 19 5382.42 2 7430 5379.85 3986 6578 46737 46737 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 821 8.4% 37.9 7.79sec 6495 5309 Direct 56.6 3636 7272 4339 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.85 56.64 0.00 0.00 1.2234 0.0000 245848.65 245848.65 0.00% 5309.22 5309.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 45.66 32 59 3635.62 2047 5042 3636.60 3355 3934 166027 166027 0.00%
crit 19.39% 10.98 3 23 7272.34 4095 10084 7256.40 5316 9107 79822 79822 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:19.04
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.80
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1651 16.9% 28.2 10.27sec 17555 14229 Direct 35.5 1540 3072 1836 19.3%
Periodic 355.4 1012 2026 1208 19.3% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.17 35.52 355.40 355.40 1.2338 2.4232 494487.17 494487.17 0.00% 551.92 14228.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 28.65 19 39 1539.71 820 2017 1539.82 1373 1675 44113 44113 0.00%
crit 19.34% 6.87 1 16 3071.92 1638 4033 3068.48 2199 3725 21098 21098 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.71% 286.85 215 362 1012.42 0 1261 1012.49 993 1033 290429 290429 0.00%
crit 19.29% 68.55 42 100 2025.56 6 2521 2025.53 1887 2114 138848 138848 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.74
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.54
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (232) 0.0% (2.4%) 4.7 65.01sec 14914 9534

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.65 0.00 0.00 0.00 1.5644 0.0000 0.00 0.00 0.00% 9533.74 9533.74

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.69
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.8 558 1116 667 19.5%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.82 0.00 0.00 0.0000 0.0000 9215.96 9215.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 11.12 4 16 558.02 558 558 558.02 558 558 6205 6205 0.00%
crit 19.53% 2.70 0 8 1116.04 1116 1116 1062.39 0 1116 3011 3011 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 201 2.1% 0.0 0.00sec 0 0 Periodic 106.0 475 953 568 19.2% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 105.99 105.99 0.0000 1.5405 60132.44 60132.44 0.00% 368.29 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 85.59 66 111 475.38 38 488 475.50 456 485 40696 40696 0.00%
crit 19.25% 20.40 8 35 952.95 76 977 952.73 828 977 19437 19437 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 597 6.1% 43.2 6.34sec 4150 2917 Direct 54.2 (54.2) 2773 5533 3306 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.20 54.25 0.00 0.00 1.4228 0.0000 179294.27 179294.27 0.00% 2916.87 2916.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 43.79 28 66 2773.23 1338 3426 2773.13 2570 2986 121414 121414 0.00%
crit 19.28% 10.46 0 26 5533.16 2627 6852 5530.41 0 6580 57880 57880 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.98
    havoc
    [R]:11.46
  • if_expr:cast_time<havoc_remains
Rain of Fire 889 9.1% 17.0 16.86sec 15614 12725 Periodic 403.6 553 1106 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.05 0.00 0.00 403.57 1.2271 0.0000 266191.17 266191.17 0.00% 12724.85 12724.85
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 325.58 224 449 552.73 507 599 552.72 544 561 179963 179963 0.00%
crit 19.33% 77.99 42 126 1105.58 1013 1198 1105.56 1087 1133 86228 86228 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.31
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.73
Soul Fire 512 5.2% 5.6 49.55sec 27601 7990 Direct 7.7 16918 33698 20009 18.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.66 0.00 0.00 3.4546 0.0000 153289.24 153289.24 0.00% 7989.64 7989.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.57% 6.25 1 10 16918.39 8616 21177 16936.61 14105 20626 105648 105648 0.00%
crit 18.43% 1.41 0 6 33698.26 17530 42352 26964.20 0 42324 47642 47642 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.48
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.15
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.71sec 12060 10428 Direct 6.0 3348 6696 4020 20.1%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24119.45 24119.45 0.00% 10427.78 10427.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.94% 4.80 1 6 3348.13 3348 3348 3348.13 3348 3348 16058 16058 0.00%
crit 20.06% 1.20 0 5 6696.27 6696 6696 5009.33 0 6696 8061 8061 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3827 / 776
Immolation 3562 7.3% 39.0 5.50sec 5480 0 Direct 117.0 1529 3061 1826 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213703.81 213703.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 94.28 83 105 1528.93 1395 2023 1528.81 1495 1557 144128 144128 0.00%
crit 19.42% 22.73 12 34 3060.59 2790 4046 3062.05 2840 3420 69576 69576 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.26sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15906.35 22720.64 29.99% 270.04 270.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 33.14 23 39 325.55 326 326 325.55 326 326 10789 15411 29.99%
crit 19.17% 7.86 2 18 651.10 651 651 651.10 651 651 5117 7310 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 526 / 526
Firebolt 526 5.4% 95.1 3.15sec 1655 1157 Direct 94.4 1395 2790 1668 19.6%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.12 94.40 0.00 0.00 1.4307 0.0000 157440.15 157440.15 0.00% 1156.95 1156.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 75.94 57 98 1395.06 1395 1395 1395.06 1395 1395 105946 105946 0.00%
crit 19.55% 18.46 6 32 2790.11 2790 2790 2790.11 2790 2790 51494 51494 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:95.56
Simple Action Stats Execute Interval
Venthyr_Nadjia
Havoc 9.6 32.25sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 0.00 0.00 0.00 1.2224 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.63
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.9 0.0 7.8sec 7.8sec 4.2sec 53.71% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.3s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.71%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.14% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • euphoria_1:11.14%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.0 78.0sec 2.0sec 66.6sec 97.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.92%
  • thrill_seeker_3:2.91%
  • thrill_seeker_4:2.89%
  • thrill_seeker_5:2.87%
  • thrill_seeker_6:2.84%
  • thrill_seeker_7:2.83%
  • thrill_seeker_8:2.81%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.73%
  • thrill_seeker_12:2.72%
  • thrill_seeker_13:2.69%
  • thrill_seeker_14:2.67%
  • thrill_seeker_15:2.65%
  • thrill_seeker_16:2.63%
  • thrill_seeker_17:2.61%
  • thrill_seeker_18:2.58%
  • thrill_seeker_19:2.56%
  • thrill_seeker_20:2.54%
  • thrill_seeker_21:2.52%
  • thrill_seeker_22:2.50%
  • thrill_seeker_23:2.48%
  • thrill_seeker_24:2.45%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.41%
  • thrill_seeker_27:2.40%
  • thrill_seeker_28:2.39%
  • thrill_seeker_29:2.37%
  • thrill_seeker_30:2.36%
  • thrill_seeker_31:2.35%
  • thrill_seeker_32:2.34%
  • thrill_seeker_33:2.33%
  • thrill_seeker_34:2.32%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.30%
  • thrill_seeker_37:2.28%
  • thrill_seeker_38:2.27%
  • thrill_seeker_39:2.27%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.8sec 180.8sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.8sec 180.8sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.62% 7.20% 13.56% 0.8s 0.0s 6.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
soul_fire Soul Shard 6.56 7.23 7.54% 1.10 0.47 6.14%
immolate Soul Shard 355.41 34.39 35.89% 0.10 1.15 3.22%
incinerate Soul Shard 43.20 10.91 11.38% 0.25 0.01 0.10%
conflagrate Soul Shard 37.84 28.31 29.54% 0.75 0.00 0.00%
mana_regen Mana 683.04 124189.05 100.00% 181.82 25388.93 16.97%
immolate_crits Soul Shard 33.89 3.29 3.43% 0.10 0.10 2.95%
incinerate_crits Soul Shard 10.47 1.05 1.09% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.66 11.12% 0.09 1.34 11.15%
pet - imp
energy_regen Energy 371.63 3633.88 100.00% 9.78 22.74 0.62%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 414.35 417.87 25407.0 48944.6 46865.5 50000.0
Soul Shard 4.0 0.32 0.32 3.1 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
cataclysm Mana 9.7 4850.7 500.0 500.5 47.9
channel_demonfire Mana 12.9 9638.1 750.0 749.5 33.6
chaos_bolt Soul Shard 22.8 45.5 2.0 2.0 12157.6
conflagrate Mana 37.8 18919.8 500.0 499.9 13.0
havoc Mana 9.6 9626.9 1000.0 1000.4 0.0
immolate Mana 28.2 21125.9 750.0 750.0 23.4
impending_catastrophe Mana 4.7 9320.9 2000.0 2004.5 7.4
incinerate Mana 43.2 43197.8 1000.0 999.9 4.2
rain_of_fire Soul Shard 17.0 51.1 3.0 3.0 5208.0
soul_fire Mana 6.6 6563.4 1000.0 1181.8 23.4
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 95.1 3804.6 40.0 40.0 41.4

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
Venthyr_Nadjia Damage Per Second
Count 520
Mean 9791.67
Minimum 9338.38
Maximum 10437.17
Spread ( max - min ) 1098.78
Range [ ( max - min ) / 2 * 100% ] 5.61%
Standard Deviation 213.4096
5th Percentile 9463.64
95th Percentile 10173.19
( 95th Percentile - 5th Percentile ) 709.55
Mean Distribution
Standard Deviation 9.3586
95.00% Confidence Interval ( 9773.33 - 9810.01 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1825
0.1 Scale Factor Error with Delta=300 389
0.05 Scale Factor Error with Delta=300 1556
0.01 Scale Factor Error with Delta=300 38879
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 520
Mean 5257.23
Minimum 4863.64
Maximum 5637.62
Spread ( max - min ) 773.99
Range [ ( max - min ) / 2 * 100% ] 7.36%
Standard Deviation 123.8541
5th Percentile 5071.68
95th Percentile 5467.38
( 95th Percentile - 5th Percentile ) 395.70
Mean Distribution
Standard Deviation 5.4314
95.00% Confidence Interval ( 5246.59 - 5267.88 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2133
0.1 Scale Factor Error with Delta=300 131
0.05 Scale Factor Error with Delta=300 524
0.01 Scale Factor Error with Delta=300 13095
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 520
Mean 9791.67
Minimum 9338.38
Maximum 10437.17
Spread ( max - min ) 1098.78
Range [ ( max - min ) / 2 * 100% ] 5.61%
Damage
Venthyr_Nadjia Damage
Count 520
Mean 2541697.61
Minimum 2015809.08
Maximum 3062006.72
Spread ( max - min ) 1046197.64
Range [ ( max - min ) / 2 * 100% ] 20.58%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.48 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.76 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.31 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.85 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.74 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.63 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.73 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 19.04 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.69 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.98 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.80 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.15 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.54 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.89 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.46 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLDJLALJEHQQRNOFFIFJLEIJLALLHNQQPNQELFJFFKLLI9AHNQNQRQPEFJFLJFLILJLAHQRNQRPN9EFIJKFLIJLAHRQRNQPEJLLLFMDJFFDLA9EHQNQNPQNDFKLFEJAILJLHQNPQRRRN9EFFIJLAIJHRQRNPQELFJKLLIJLLAHOQNQNEIFFFLJLIL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.924 cds M summon_infernal Fluffy_Pillow 49712.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust, thrill_seeker
0:04.930 aoe H havoc enemy2 49215.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust, thrill_seeker(3)
0:05.936 havoc Q chaos_bolt Fluffy_Pillow 48718.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust, thrill_seeker(3)
0:07.944 havoc N conflagrate Fluffy_Pillow 49722.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(4)
0:08.950 havoc Q chaos_bolt Fluffy_Pillow 49725.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(5)
0:10.357 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, thrill_seeker(6)
0:11.362 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft, thrill_seeker(6)
0:12.368 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, thrill_seeker(7)
0:13.774 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(7)
0:14.780 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, thrill_seeker(8)
0:16.185 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, thrill_seeker(9)
0:17.195 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft, thrill_seeker(9)
0:18.202 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft, thrill_seeker(10)
0:20.658 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:21.664 aoe F immolate enemy2 49252.0/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:22.671 aoe F immolate enemy3 49005.5/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:23.677 aoe D rain_of_fire Fluffy_Pillow 48758.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:24.683 aoe K impending_catastrophe Fluffy_Pillow 49261.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft, thrill_seeker(13)
0:26.024 aoe L incinerate Fluffy_Pillow 47932.0/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:26.965 aoe J conflagrate Fluffy_Pillow 47402.5/50000: 95% mana
1.6/5: 32% soul_shard
bloodlust, thrill_seeker(14)
0:27.973 aoe L incinerate Fluffy_Pillow 47406.5/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:28.912 aoe D rain_of_fire Fluffy_Pillow 46876.0/50000: 94% mana
3.1/5: 62% soul_shard
bloodlust, thrill_seeker(15)
0:29.919 aoe J conflagrate Fluffy_Pillow 47379.5/50000: 95% mana
0.6/5: 12% soul_shard
bloodlust, thrill_seeker(15)
0:30.927 aoe L incinerate Fluffy_Pillow 47383.5/50000: 95% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, thrill_seeker(16)
0:31.867 default A cataclysm Fluffy_Pillow 46853.5/50000: 94% mana
2.0/5: 40% soul_shard
bloodlust, thrill_seeker(16)
0:33.208 aoe L incinerate Fluffy_Pillow 47024.0/50000: 94% mana
2.4/5: 48% soul_shard
bloodlust, thrill_seeker(17)
0:34.549 aoe J conflagrate Fluffy_Pillow 46694.5/50000: 93% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(18)
0:35.563 aoe E channel_demonfire Fluffy_Pillow 46701.5/50000: 93% mana
3.6/5: 72% soul_shard
bloodlust, backdraft, thrill_seeker(18)
0:37.730 aoe H havoc enemy2 47035.0/50000: 94% mana
4.0/5: 80% soul_shard
bloodlust, backdraft, thrill_seeker(19)
0:38.735 havoc Q chaos_bolt Fluffy_Pillow 46537.5/50000: 93% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(20)
0:40.142 havoc Q chaos_bolt Fluffy_Pillow 47241.0/50000: 94% mana
2.5/5: 50% soul_shard
bloodlust, thrill_seeker(21)
0:42.151 havoc R incinerate Fluffy_Pillow 48245.5/50000: 96% mana
0.8/5: 16% soul_shard
thrill_seeker(22)
0:43.890 havoc N conflagrate Fluffy_Pillow 48115.0/50000: 96% mana
1.3/5: 26% soul_shard
thrill_seeker(22)
0:45.196 havoc O soul_fire Fluffy_Pillow 48268.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(23)
0:48.674 aoe F immolate enemy2 49002.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft, thrill_seeker(25)
0:49.980 aoe F immolate Fluffy_Pillow 48905.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(25)
0:51.287 aoe I rain_of_fire Fluffy_Pillow 48809.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(26)
0:52.593 aoe F immolate enemy3 49462.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(27)
0:53.900 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.3/5: 46% soul_shard
thrill_seeker(27)
0:55.208 aoe L incinerate Fluffy_Pillow 49406.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker(28)
0:56.427 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
thrill_seeker(29)
0:59.354 aoe I rain_of_fire Fluffy_Pillow 49715.5/50000: 99% mana
3.8/5: 76% soul_shard
thrill_seeker(30)
1:00.659 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
thrill_seeker(31)
1:01.966 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(31)
1:03.184 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(32)
1:04.944 aoe L incinerate Fluffy_Pillow 49381.5/50000: 99% mana
2.1/5: 42% soul_shard
thrill_seeker(33)
1:06.685 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
thrill_seeker(34)
1:08.425 aoe H havoc enemy2 48872.5/50000: 98% mana
3.1/5: 62% soul_shard
thrill_seeker(35)
1:09.731 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.2/5: 64% soul_shard
thrill_seeker(35)
1:11.038 havoc Q chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(36)
1:12.867 havoc Q chaos_bolt Fluffy_Pillow 49593.5/50000: 99% mana
2.5/5: 50% soul_shard
thrill_seeker(37)
1:15.477 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
thrill_seeker(38)
1:16.785 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.1/5: 22% soul_shard
thrill_seeker(39)
1:18.091 havoc Q chaos_bolt Fluffy_Pillow 49406.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, euphoria
1:19.614 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
euphoria
1:22.030 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
thrill_seeker(3), euphoria
1:23.480 aoe F immolate enemy3 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(3), euphoria
1:24.571 aoe J conflagrate Fluffy_Pillow 48797.0/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(4), euphoria
1:25.659 aoe F immolate Fluffy_Pillow 48841.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(4), euphoria
1:26.749 aoe F immolate enemy2 48636.0/50000: 97% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(5), euphoria
1:27.838 aoe K impending_catastrophe Fluffy_Pillow 48430.5/50000: 97% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(5), euphoria
1:29.289 aoe L incinerate Fluffy_Pillow 47156.0/50000: 94% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(6)
1:30.507 aoe L incinerate Fluffy_Pillow 46765.0/50000: 94% mana
3.0/5: 60% soul_shard
thrill_seeker(7)
1:32.246 aoe I rain_of_fire Fluffy_Pillow 46634.5/50000: 93% mana
3.5/5: 70% soul_shard
thrill_seeker(8)
1:33.553 default 9 soul_fire Fluffy_Pillow 47288.0/50000: 95% mana
0.6/5: 12% soul_shard
thrill_seeker(8)
1:37.147 default A cataclysm Fluffy_Pillow 48085.0/50000: 96% mana
2.0/5: 40% soul_shard
thrill_seeker(10)
1:38.887 aoe H havoc enemy2 48455.0/50000: 97% mana
2.3/5: 46% soul_shard
thrill_seeker(11)
1:40.194 havoc N conflagrate Fluffy_Pillow 48108.5/50000: 96% mana
2.5/5: 50% soul_shard
thrill_seeker(12)
1:41.500 havoc Q chaos_bolt Fluffy_Pillow 48261.5/50000: 97% mana
3.7/5: 74% soul_shard
backdraft, thrill_seeker(12)
1:43.328 havoc N conflagrate Fluffy_Pillow 49175.5/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(13)
1:44.634 havoc Q chaos_bolt Fluffy_Pillow 49328.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker(14)
1:46.462 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
thrill_seeker(15)
1:48.201 havoc Q chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.1/5: 42% soul_shard
thrill_seeker(16)
1:50.809 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
thrill_seeker(17)
1:52.115 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.4/5: 8% soul_shard
thrill_seeker(18)
1:54.956 aoe F immolate enemy2 49922.5/50000: 100% mana
0.7/5: 14% soul_shard
thrill_seeker(19)
1:56.263 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
thrill_seeker(20)
1:57.569 aoe F immolate enemy3 49405.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft, thrill_seeker(20)
1:58.875 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(21)
2:00.095 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(22)
2:01.402 aoe F immolate Fluffy_Pillow 49015.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(22)
2:02.709 aoe L incinerate Fluffy_Pillow 48919.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(23)
2:03.929 aoe I rain_of_fire Fluffy_Pillow 48529.0/50000: 97% mana
3.2/5: 64% soul_shard
thrill_seeker(23)
2:05.236 aoe L incinerate Fluffy_Pillow 49182.5/50000: 98% mana
0.4/5: 8% soul_shard
thrill_seeker(24)
2:06.978 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(25)
2:08.284 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(26)
2:09.504 default A cataclysm Fluffy_Pillow 48766.0/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(26)
2:11.246 aoe H havoc enemy2 49137.0/50000: 98% mana
2.2/5: 44% soul_shard
thrill_seeker(27)
2:12.553 havoc Q chaos_bolt Fluffy_Pillow 48790.5/50000: 98% mana
2.4/5: 48% soul_shard
thrill_seeker(28)
2:15.163 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
thrill_seeker(29)
2:16.903 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
thrill_seeker(30)
2:18.210 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(31)
2:20.036 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
thrill_seeker(32)
2:21.778 havoc P immolate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(32)
2:23.084 havoc N conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(33)
2:24.391 default 9 soul_fire Fluffy_Pillow 49059.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(34)
2:27.869 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft, thrill_seeker(35)
2:30.735 aoe F immolate enemy3 49685.5/50000: 99% mana
4.3/5: 86% soul_shard
backdraft, thrill_seeker(37)
2:32.041 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
backdraft, thrill_seeker(38)
2:33.349 aoe J conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
1.6/5: 32% soul_shard
thrill_seeker(38)
2:34.657 aoe K impending_catastrophe Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(39)
2:36.398 aoe F immolate enemy2 48002.5/50000: 96% mana
2.5/5: 50% soul_shard
backdraft, euphoria
2:37.488 aoe L incinerate Fluffy_Pillow 47797.5/50000: 96% mana
2.6/5: 52% soul_shard
backdraft, euphoria
2:38.505 aoe I rain_of_fire Fluffy_Pillow 47306.0/50000: 95% mana
3.0/5: 60% soul_shard
thrill_seeker, euphoria
2:39.592 aoe J conflagrate Fluffy_Pillow 47849.5/50000: 96% mana
0.1/5: 2% soul_shard
thrill_seeker, euphoria
2:40.719 aoe L incinerate Fluffy_Pillow 47913.0/50000: 96% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(3), euphoria
2:41.735 default A cataclysm Fluffy_Pillow 47421.0/50000: 95% mana
1.1/5: 22% soul_shard
thrill_seeker(3), euphoria
2:43.188 aoe H havoc enemy2 47647.5/50000: 95% mana
1.3/5: 26% soul_shard
thrill_seeker(4), euphoria
2:44.277 havoc R incinerate Fluffy_Pillow 47192.0/50000: 94% mana
1.5/5: 30% soul_shard
thrill_seeker(5), euphoria
2:45.729 havoc Q chaos_bolt Fluffy_Pillow 46918.0/50000: 94% mana
2.1/5: 42% soul_shard
thrill_seeker(5), euphoria
2:47.905 havoc R incinerate Fluffy_Pillow 48006.0/50000: 96% mana
0.5/5: 10% soul_shard
thrill_seeker(6)
2:49.645 havoc N conflagrate Fluffy_Pillow 47876.0/50000: 96% mana
1.1/5: 22% soul_shard
thrill_seeker(7)
2:50.953 havoc Q chaos_bolt Fluffy_Pillow 48030.0/50000: 96% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(8)
2:52.779 havoc P immolate Fluffy_Pillow 48943.0/50000: 98% mana
0.5/5: 10% soul_shard
thrill_seeker(9)
2:54.085 aoe E channel_demonfire Fluffy_Pillow 48846.0/50000: 98% mana
0.7/5: 14% soul_shard
thrill_seeker(10)
2:57.084 aoe J conflagrate Fluffy_Pillow 49595.5/50000: 99% mana
1.1/5: 22% soul_shard
thrill_seeker(11)
2:58.390 aoe L incinerate Fluffy_Pillow 49748.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(12)
2:59.609 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
thrill_seeker(12)
3:01.349 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
2.6/5: 52% soul_shard
thrill_seeker(13)
3:03.090 aoe F immolate enemy3 48742.5/50000: 97% mana
3.2/5: 64% soul_shard
thrill_seeker(14)
3:04.394 cds M summon_infernal Fluffy_Pillow 48644.5/50000: 97% mana
3.3/5: 66% soul_shard
thrill_seeker(15)
3:05.701 aoe D rain_of_fire Fluffy_Pillow 48298.0/50000: 97% mana
3.7/5: 74% soul_shard
thrill_seeker(15)
3:07.008 aoe J conflagrate Fluffy_Pillow 48951.5/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(16)
3:08.315 aoe F immolate enemy2 49105.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(17)
3:09.622 aoe F immolate Fluffy_Pillow 49008.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(17)
3:10.929 aoe D rain_of_fire Fluffy_Pillow 48912.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker(18)
3:12.237 aoe L incinerate Fluffy_Pillow 49566.0/50000: 99% mana
0.3/5: 6% soul_shard
backdraft, thrill_seeker(19)
3:13.456 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(19)
3:15.196 default 9 soul_fire Fluffy_Pillow 49372.0/50000: 99% mana
1.6/5: 32% soul_shard
thrill_seeker(20)
3:18.672 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
3.7/5: 74% soul_shard
thrill_seeker(22)
3:21.437 aoe H havoc enemy2 49634.0/50000: 99% mana
4.6/5: 92% soul_shard
thrill_seeker(23)
3:22.742 havoc Q chaos_bolt Fluffy_Pillow 49286.5/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(24)
3:25.351 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(25)
3:26.657 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(26)
3:28.485 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(27)
3:29.791 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(27)
3:31.097 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.8/5: 96% soul_shard
backdraft, thrill_seeker(28)
3:32.924 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(29)
3:34.230 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, thrill_seeker(30)
3:35.537 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(30)
3:36.843 aoe K impending_catastrophe Fluffy_Pillow 49252.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, thrill_seeker(31)
3:38.583 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(32)
3:39.802 aoe F immolate enemy2 47611.5/50000: 95% mana
2.6/5: 52% soul_shard
thrill_seeker(32)
3:41.109 aoe E channel_demonfire Fluffy_Pillow 47515.0/50000: 95% mana
2.7/5: 54% soul_shard
thrill_seeker(33)
3:43.887 aoe J conflagrate Fluffy_Pillow 48154.0/50000: 96% mana
3.0/5: 60% soul_shard
thrill_seeker(34)
3:45.193 default A cataclysm Fluffy_Pillow 48307.0/50000: 97% mana
3.7/5: 74% soul_shard
backdraft, thrill_seeker(35)
3:46.934 aoe I rain_of_fire Fluffy_Pillow 48677.5/50000: 97% mana
4.0/5: 80% soul_shard
backdraft, thrill_seeker(36)
3:48.241 aoe L incinerate Fluffy_Pillow 49331.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(37)
3:49.460 aoe J conflagrate Fluffy_Pillow 48940.5/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(37)
3:50.766 aoe L incinerate Fluffy_Pillow 49093.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(38)
3:51.985 aoe H havoc enemy2 48703.0/50000: 97% mana
2.4/5: 48% soul_shard
thrill_seeker(38)
3:53.292 havoc Q chaos_bolt Fluffy_Pillow 48356.5/50000: 97% mana
2.6/5: 52% soul_shard
thrill_seeker(39)
3:55.901 havoc N conflagrate Fluffy_Pillow 49661.0/50000: 99% mana
1.1/5: 22% soul_shard
euphoria
3:56.989 havoc P immolate Fluffy_Pillow 49705.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker, euphoria
3:58.078 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(3), euphoria
3:59.601 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
thrill_seeker(3), euphoria
4:01.052 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(4), euphoria
4:02.504 havoc R incinerate Fluffy_Pillow 48728.0/50000: 97% mana
1.8/5: 36% soul_shard
thrill_seeker(5), euphoria
4:03.956 havoc N conflagrate Fluffy_Pillow 48454.0/50000: 97% mana
2.6/5: 52% soul_shard
thrill_seeker(5), euphoria
4:05.046 default 9 soul_fire Fluffy_Pillow 48499.0/50000: 97% mana
3.7/5: 74% soul_shard
backdraft, thrill_seeker(6)
4:08.523 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(8)
4:11.376 aoe F immolate enemy3 49678.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(9)
4:12.681 aoe F immolate enemy2 49251.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(10)
4:13.986 aoe I rain_of_fire Fluffy_Pillow 49154.0/50000: 98% mana
5.0/5: 100% soul_shard
thrill_seeker(10)
4:15.293 aoe J conflagrate Fluffy_Pillow 49807.5/50000: 100% mana
2.1/5: 42% soul_shard
thrill_seeker(11)
4:16.600 aoe L incinerate Fluffy_Pillow 49961.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(12)
4:17.819 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
3.0/5: 60% soul_shard
thrill_seeker(12)
4:19.559 aoe I rain_of_fire Fluffy_Pillow 49372.0/50000: 99% mana
3.4/5: 68% soul_shard
thrill_seeker(13)
4:20.865 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
thrill_seeker(14)
4:22.172 aoe H havoc enemy2 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft, thrill_seeker(15)
4:23.477 havoc R incinerate Fluffy_Pillow 49652.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft, thrill_seeker(15)
4:24.697 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(16)
4:27.305 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
thrill_seeker(17)
4:29.045 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
thrill_seeker(18)
4:30.352 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(19)
4:31.660 havoc Q chaos_bolt Fluffy_Pillow 49059.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(19)
4:33.488 aoe E channel_demonfire Fluffy_Pillow 49973.5/50000: 100% mana
0.4/5: 8% soul_shard
thrill_seeker(20)
4:36.352 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
thrill_seeker(22)
4:38.093 aoe F immolate enemy3 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(23)
4:39.399 aoe J conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(23)
4:40.707 aoe K impending_catastrophe Fluffy_Pillow 49059.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(24)
4:42.447 aoe L incinerate Fluffy_Pillow 47929.5/50000: 96% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(25)
4:43.664 aoe L incinerate Fluffy_Pillow 47538.0/50000: 95% mana
2.6/5: 52% soul_shard
thrill_seeker(25)
4:45.403 aoe I rain_of_fire Fluffy_Pillow 47407.5/50000: 95% mana
3.2/5: 64% soul_shard
thrill_seeker(26)
4:46.710 aoe J conflagrate Fluffy_Pillow 48061.0/50000: 96% mana
0.3/5: 6% soul_shard
thrill_seeker(27)
4:48.016 aoe L incinerate Fluffy_Pillow 48214.0/50000: 96% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(28)
4:49.234 aoe L incinerate Fluffy_Pillow 47823.0/50000: 96% mana
1.4/5: 28% soul_shard
thrill_seeker(28)
4:50.974 default A cataclysm Fluffy_Pillow 47693.0/50000: 95% mana
2.2/5: 44% soul_shard
thrill_seeker(29)
4:52.715 aoe H havoc enemy2 48063.5/50000: 96% mana
2.3/5: 46% soul_shard
thrill_seeker(30)
4:54.021 havoc O soul_fire Fluffy_Pillow 47716.5/50000: 95% mana
2.3/5: 46% soul_shard
thrill_seeker(31)
4:57.497 havoc Q chaos_bolt Fluffy_Pillow 48454.5/50000: 97% mana
4.7/5: 94% soul_shard
thrill_seeker(32)
5:00.107 havoc N conflagrate Fluffy_Pillow 49759.5/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(34)
5:01.415 havoc Q chaos_bolt Fluffy_Pillow 49913.5/50000: 100% mana
4.2/5: 84% soul_shard
backdraft, thrill_seeker(34)
5:03.242 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
thrill_seeker(35)
5:04.692 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(36)
5:07.522 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
backdraft, thrill_seeker(37)
5:08.831 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(38)
5:10.137 aoe F immolate enemy2 49252.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft, thrill_seeker(39)
5:11.445 aoe F immolate enemy3 49156.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(39)
5:12.753 aoe L incinerate Fluffy_Pillow 49060.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, euphoria
5:13.770 aoe J conflagrate Fluffy_Pillow 48568.5/50000: 97% mana
2.1/5: 42% soul_shard
euphoria
5:14.859 aoe L incinerate Fluffy_Pillow 48613.0/50000: 97% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker, euphoria
5:15.876 aoe I rain_of_fire Fluffy_Pillow 48121.5/50000: 96% mana
3.1/5: 62% soul_shard
thrill_seeker, euphoria
5:16.965 aoe L incinerate Fluffy_Pillow 48666.0/50000: 97% mana
0.3/5: 6% soul_shard
thrill_seeker(3), euphoria

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Nadjia"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=331586/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Theotar : 9734 dps, 5195 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9733.9 9733.9 18.6 / 0.191% 823.0 / 8.5% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
409.7 406.4 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 9734
Cataclysm 794 8.2% 9.7 32.39sec 24608 14484 Direct 29.0 6879 13749 8198 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.66 28.98 0.00 0.00 1.6991 0.0000 237749.17 237749.17 0.00% 14483.65 14483.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 23.41 15 35 6878.65 6141 8765 6880.42 6470 7593 161068 161068 0.00%
crit 19.25% 5.58 0 13 13749.21 12283 17531 13715.33 0 16960 76681 76681 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.73
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1063) 0.0% (10.9%) 12.3 25.23sec 25904 9617

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.28 0.00 183.39 0.00 2.6937 0.1635 0.00 0.00 0.00% 9616.77 9616.77

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.28
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1063 10.9% 0.0 0.00sec 0 0 Direct 550.2 484 971 578 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 550.18 0.00 0.00 0.0000 0.0000 318170.97 318170.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 443.69 321 566 483.94 263 1179 484.20 454 527 214704 214704 0.00%
crit 19.36% 106.49 66 149 971.48 525 2357 972.02 834 1135 103467 103467 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1403 (1888) 14.4% (19.4%) 22.7 12.96sec 24877 12645 Direct 45.2 (89.9) 0 9293 9293 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.69 45.15 0.00 0.00 1.9673 0.0000 419643.40 419643.40 0.00% 12644.96 12644.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.15 34 60 9293.30 5861 14780 9294.11 8891 10189 419643 419643 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.76
  • if_expr:cast_time<havoc_remains
    Internal Combustion 485 5.0% 44.8 12.93sec 3236 0 Direct 44.8 2708 5410 3237 19.6%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.78 44.78 0.00 0.00 0.0000 0.0000 144916.24 144916.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 36.03 22 53 2707.63 2 4484 2709.37 2472 3003 97546 97546 0.00%
crit 19.55% 8.76 2 20 5409.95 35 8968 5420.77 3997 6575 47370 47370 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 825 8.5% 37.0 7.92sec 6669 5336 Direct 55.7 3727 7413 4434 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.04 55.71 0.00 0.00 1.2498 0.0000 247014.29 247014.29 0.00% 5336.23 5336.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 45.01 31 62 3727.50 2047 6087 3728.06 3409 4044 167773 167773 0.00%
crit 19.19% 10.69 4 21 7412.61 4094 12172 7402.71 5502 9387 79241 79241 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.41
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.61
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1655 17.0% 28.1 10.33sec 17624 13945 Direct 35.2 1580 3164 1886 19.4%
Periodic 345.9 1041 2079 1242 19.3% 95.5%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.13 35.16 345.89 345.89 1.2638 2.4820 495789.36 495789.36 0.00% 554.54 13945.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 28.35 18 42 1579.80 819 2434 1580.04 1442 1775 44770 44770 0.00%
crit 19.39% 6.82 1 14 3164.32 1645 4871 3162.97 2304 4026 21566 21566 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.70% 279.14 211 346 1041.37 1 1522 1041.46 1011 1088 290700 290700 0.00%
crit 19.30% 66.75 42 94 2078.70 5 3044 2078.50 1956 2226 138753 138753 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:20.01
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.21
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (227) 0.0% (2.3%) 4.7 64.81sec 14510 8768

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.68 0.00 0.00 0.00 1.6551 0.0000 0.00 0.00 0.00% 8768.02 8768.02

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.71
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 558 1116 665 19.2%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.94 0.00 0.00 0.0000 0.0000 9273.90 9273.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 11.26 5 17 558.02 558 558 558.02 558 558 6282 6282 0.00%
crit 19.23% 2.68 0 8 1116.04 1116 1116 1058.10 0 1116 2992 2992 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 196 2.0% 0.0 0.00sec 0 0 Periodic 101.6 484 967 577 19.3% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 101.61 101.61 0.0000 1.6133 58643.19 58643.19 0.00% 357.73 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.66% 81.96 62 111 483.60 446 488 483.61 482 486 39636 39636 0.00%
crit 19.34% 19.65 10 34 967.19 891 977 967.28 950 977 19007 19007 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 589 6.1% 41.6 6.55sec 4250 2905 Direct 52.2 (52.2) 2848 5666 3391 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.60 52.16 0.00 0.00 1.4633 0.0000 176807.09 176807.09 0.00% 2904.57 2904.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 42.12 27 67 2847.64 1340 4136 2848.86 2597 3065 119924 119924 0.00%
crit 19.24% 10.03 1 21 5666.06 2753 8272 5675.83 4315 7208 56883 56883 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.90
    havoc
    [R]:10.96
  • if_expr:cast_time<havoc_remains
Rain of Fire 873 9.0% 16.3 17.43sec 16075 12873 Periodic 385.6 569 1136 678 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.26 0.00 0.00 385.57 1.2488 0.0000 261312.36 261312.36 0.00% 12872.53 12872.53
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 311.50 207 451 568.79 507 723 568.66 547 602 177152 177152 0.00%
crit 19.21% 74.07 38 123 1136.45 1013 1447 1136.19 1086 1209 84160 84160 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.13
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.13
Soul Fire 514 5.3% 5.6 49.46sec 27644 7950 Direct 7.5 17173 34516 20395 18.5%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.56 7.54 0.00 0.00 3.4775 0.0000 153688.93 153688.93 0.00% 7949.56 7949.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.48% 6.14 1 9 17173.07 8656 25543 17217.78 13364 24752 105589 105589 0.00%
crit 18.52% 1.40 0 5 34516.22 17335 50912 27910.32 0 50912 48100 48100 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.62
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.03
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.49sec 11970 10354 Direct 6.0 3348 6696 3982 19.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23939.17 23939.17 0.00% 10354.31 10354.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 4.85 2 6 3348.13 3348 3348 3348.13 3348 3348 16238 16238 0.00%
crit 19.17% 1.15 0 4 6696.27 6696 6696 4983.57 0 6696 7701 7701 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3514 / 712
Immolation 3249 6.7% 39.0 5.49sec 4998 0 Direct 117.0 1395 2790 1665 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194929.60 194929.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 94.27 82 106 1395.06 1395 1395 1395.06 1395 1395 131514 131514 0.00%
crit 19.43% 22.73 11 35 2790.11 2790 2790 2790.11 2790 2790 63416 63416 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.5% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15942.67 22772.50 29.99% 270.66 270.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 33.03 25 39 325.55 326 326 325.55 326 326 10753 15359 29.99%
crit 19.44% 7.97 2 16 651.10 651 651 651.10 651 651 5190 7413 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 93.2 3.21sec 1650 1133 Direct 92.5 1395 2790 1663 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 153791.54 153791.54 0.00% 1133.21 1133.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 74.76 55 95 1395.06 1395 1395 1395.06 1395 1395 104289 104289 0.00%
crit 19.18% 17.74 6 31 2790.11 2790 2790 2790.11 2790 2790 49503 49503 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
Venthyr_Theotar
Havoc 9.6 32.21sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.60 0.00 0.00 0.00 1.2440 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.61
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 7.9sec 7.9sec 4.4sec 54.26% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.5s
  • trigger_min/max:1.9s / 23.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.26%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 63.2sec 63.2sec 11.8sec 16.67% 0.00% 0.0 (0.0) 4.1

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 227.6s
  • trigger_min/max:20.0s / 227.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.67%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.7s
  • trigger_min/max:180.0s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.7s
  • trigger_min/max:180.0s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.64% 8.99% 14.40% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
soul_fire Soul Shard 6.57 7.20 7.71% 1.10 0.39 5.13%
immolate Soul Shard 345.87 33.33 35.71% 0.10 1.25 3.63%
incinerate Soul Shard 41.62 10.50 11.25% 0.25 0.00 0.02%
conflagrate Soul Shard 37.03 27.84 29.83% 0.75 0.00 0.00%
mana_regen Mana 655.49 121819.75 100.00% 185.84 27731.35 18.54%
immolate_crits Soul Shard 33.26 3.21 3.44% 0.10 0.12 3.57%
incinerate_crits Soul Shard 10.06 1.01 1.08% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.25 10.98% 0.09 1.75 14.62%
pet - imp
energy_regen Energy 360.75 3557.55 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.39 409.72 27767.2 49002.3 46421.0 50000.0
Soul Shard 4.0 0.31 0.31 3.5 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
cataclysm Mana 9.7 4835.8 500.0 500.5 49.2
channel_demonfire Mana 12.3 9211.3 750.0 749.9 34.5
chaos_bolt Soul Shard 22.7 45.3 2.0 2.0 12458.0
conflagrate Mana 37.0 18513.1 500.0 499.8 13.3
havoc Mana 9.6 9611.9 1000.0 1001.0 0.0
immolate Mana 28.1 21086.8 750.0 749.6 23.5
impending_catastrophe Mana 4.7 9380.6 2000.0 2004.1 7.2
incinerate Mana 41.6 41623.1 1000.0 1000.6 4.2
rain_of_fire Soul Shard 16.3 48.8 3.0 3.0 5356.6
soul_fire Mana 6.6 6569.0 1000.0 1181.6 23.4
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
Venthyr_Theotar Damage Per Second
Count 520
Mean 9733.90
Minimum 9162.87
Maximum 10332.24
Spread ( max - min ) 1169.38
Range [ ( max - min ) / 2 * 100% ] 6.01%
Standard Deviation 216.8451
5th Percentile 9402.76
95th Percentile 10091.77
( 95th Percentile - 5th Percentile ) 689.00
Mean Distribution
Standard Deviation 9.5093
95.00% Confidence Interval ( 9715.26 - 9752.54 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1907
0.1 Scale Factor Error with Delta=300 402
0.05 Scale Factor Error with Delta=300 1606
0.01 Scale Factor Error with Delta=300 40141
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 520
Mean 5194.68
Minimum 4801.21
Maximum 5655.21
Spread ( max - min ) 854.00
Range [ ( max - min ) / 2 * 100% ] 8.22%
Standard Deviation 128.3317
5th Percentile 4991.69
95th Percentile 5411.04
( 95th Percentile - 5th Percentile ) 419.35
Mean Distribution
Standard Deviation 5.6277
95.00% Confidence Interval ( 5183.65 - 5205.71 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2345
0.1 Scale Factor Error with Delta=300 141
0.05 Scale Factor Error with Delta=300 563
0.01 Scale Factor Error with Delta=300 14059
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 520
Mean 9733.90
Minimum 9162.87
Maximum 10332.24
Spread ( max - min ) 1169.38
Range [ ( max - min ) / 2 * 100% ] 6.01%
Damage
Venthyr_Theotar Damage
Count 520
Mean 2546948.05
Minimum 2040943.18
Maximum 3057615.85
Spread ( max - min ) 1016672.68
Range [ ( max - min ) / 2 * 100% ] 19.96%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.62 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.73 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.13 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.28 channel_demonfire,if=dot.immolate.remains>cast_time
F 20.01 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.61 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.13 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.41 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.71 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.90 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.61 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.03 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.21 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.76 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.96 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFDFKLJLDJLALJEHQQRPNQ9FJLEFIJLALJHQRQPRNEIFKLJLLJIA9HQRNQRNPEFFILJLLLAJIHRRNQRRPE9FFIJKLIAHRNQNQPEJLLJFILMFFJLDAE9HQNQNQPDFJEKLLIAJLLHNQRQPRNE9FFFIJALIHRNQRNPREIJFLKLJILLAHNQOPNREILJFILLL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.011 cds M summon_infernal Fluffy_Pillow 49755.5/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust
0:05.017 aoe H havoc enemy2 49258.5/50000: 99% mana
4.6/5: 92% soul_shard
bloodlust
0:06.023 havoc Q chaos_bolt Fluffy_Pillow 48761.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.032 havoc N conflagrate Fluffy_Pillow 49766.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.038 havoc Q chaos_bolt Fluffy_Pillow 49769.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.444 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:11.449 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:12.456 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.865 havoc N conflagrate Fluffy_Pillow 49957.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soothing_shade
0:14.872 havoc Q chaos_bolt Fluffy_Pillow 49960.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, soothing_shade
0:16.278 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, soothing_shade
0:17.285 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft, soothing_shade
0:18.291 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, soothing_shade
0:20.794 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, soothing_shade
0:21.801 aoe F immolate enemy2 49252.5/50000: 99% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, soothing_shade
0:22.808 aoe D rain_of_fire Fluffy_Pillow 49006.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, soothing_shade
0:23.816 aoe F immolate enemy3 49510.0/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust, backdraft, soothing_shade
0:24.822 aoe K impending_catastrophe Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft, soothing_shade
0:26.162 aoe L incinerate Fluffy_Pillow 47922.0/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust, backdraft
0:27.101 aoe J conflagrate Fluffy_Pillow 47391.5/50000: 95% mana
1.7/5: 34% soul_shard
bloodlust
0:28.107 aoe L incinerate Fluffy_Pillow 47394.5/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:29.049 aoe D rain_of_fire Fluffy_Pillow 46865.5/50000: 94% mana
3.1/5: 62% soul_shard
bloodlust
0:30.057 aoe J conflagrate Fluffy_Pillow 47369.5/50000: 95% mana
0.4/5: 8% soul_shard
bloodlust
0:31.064 aoe L incinerate Fluffy_Pillow 47373.0/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:32.005 default A cataclysm Fluffy_Pillow 46843.5/50000: 94% mana
1.7/5: 34% soul_shard
bloodlust
0:33.346 aoe L incinerate Fluffy_Pillow 47014.0/50000: 94% mana
2.2/5: 44% soul_shard
bloodlust
0:34.686 aoe J conflagrate Fluffy_Pillow 46684.0/50000: 93% mana
2.7/5: 54% soul_shard
bloodlust
0:35.692 aoe E channel_demonfire Fluffy_Pillow 46687.0/50000: 93% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:37.927 aoe H havoc enemy2 47054.5/50000: 94% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:38.934 havoc Q chaos_bolt Fluffy_Pillow 46558.0/50000: 93% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:40.339 havoc Q chaos_bolt Fluffy_Pillow 47260.5/50000: 95% mana
2.1/5: 42% soul_shard
bloodlust
0:42.349 havoc R incinerate Fluffy_Pillow 48265.5/50000: 97% mana
0.4/5: 8% soul_shard
0:44.091 havoc P immolate Fluffy_Pillow 48136.5/50000: 96% mana
1.0/5: 20% soul_shard
0:45.397 havoc N conflagrate Fluffy_Pillow 48039.5/50000: 96% mana
1.1/5: 22% soul_shard
0:46.704 havoc Q chaos_bolt Fluffy_Pillow 48193.0/50000: 96% mana
2.3/5: 46% soul_shard
backdraft
0:48.533 default 9 soul_fire Fluffy_Pillow 49107.5/50000: 98% mana
0.6/5: 12% soul_shard
0:52.011 aoe F immolate enemy3 49002.5/50000: 98% mana
1.9/5: 38% soul_shard
0:53.318 aoe J conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
2.2/5: 44% soul_shard
0:54.625 aoe L incinerate Fluffy_Pillow 49059.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
0:55.845 aoe E channel_demonfire Fluffy_Pillow 48669.5/50000: 97% mana
3.0/5: 60% soul_shard
0:58.721 aoe F immolate enemy2 49357.5/50000: 99% mana
3.6/5: 72% soul_shard
1:00.026 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
3.9/5: 78% soul_shard
1:01.332 aoe J conflagrate Fluffy_Pillow 49904.5/50000: 100% mana
1.1/5: 22% soul_shard
1:02.638 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft, soothing_shade
1:03.857 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
soothing_shade
1:05.597 aoe L incinerate Fluffy_Pillow 49372.0/50000: 99% mana
2.4/5: 48% soul_shard
soothing_shade
1:07.340 aoe J conflagrate Fluffy_Pillow 49003.5/50000: 98% mana
2.7/5: 54% soul_shard
soothing_shade
1:08.647 aoe H havoc enemy2 49157.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, soothing_shade
1:09.953 havoc Q chaos_bolt Fluffy_Pillow 48810.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, soothing_shade
1:11.780 havoc R incinerate Fluffy_Pillow 49723.5/50000: 99% mana
1.8/5: 36% soul_shard
soothing_shade
1:13.520 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
soothing_shade
1:16.128 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:17.435 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.0/5: 20% soul_shard
1:19.176 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
1:20.482 aoe E channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:23.370 aoe I rain_of_fire Fluffy_Pillow 49849.5/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
1:24.676 aoe F immolate enemy3 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
1:25.982 aoe K impending_catastrophe Fluffy_Pillow 49252.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
1:27.899 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
0.7/5: 14% soul_shard
backdraft
1:29.118 aoe J conflagrate Fluffy_Pillow 47612.0/50000: 95% mana
1.1/5: 22% soul_shard
1:30.423 aoe L incinerate Fluffy_Pillow 47764.5/50000: 96% mana
1.7/5: 34% soul_shard
backdraft
1:31.642 aoe L incinerate Fluffy_Pillow 47374.0/50000: 95% mana
2.2/5: 44% soul_shard
1:33.381 aoe J conflagrate Fluffy_Pillow 47243.5/50000: 94% mana
2.6/5: 52% soul_shard
1:34.687 aoe I rain_of_fire Fluffy_Pillow 47396.5/50000: 95% mana
3.3/5: 66% soul_shard
backdraft
1:35.991 default A cataclysm Fluffy_Pillow 48048.5/50000: 96% mana
0.6/5: 12% soul_shard
backdraft
1:37.731 default 9 soul_fire Fluffy_Pillow 48418.5/50000: 97% mana
0.7/5: 14% soul_shard
backdraft
1:41.209 aoe H havoc enemy2 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
1:42.514 havoc Q chaos_bolt Fluffy_Pillow 48655.0/50000: 97% mana
2.1/5: 42% soul_shard
backdraft
1:44.341 havoc R incinerate Fluffy_Pillow 49568.5/50000: 99% mana
0.4/5: 8% soul_shard
1:46.081 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
1:47.387 havoc Q chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
1:49.213 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:50.952 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
1:52.260 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
1:53.568 aoe E channel_demonfire Fluffy_Pillow 49059.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:56.359 aoe F immolate enemy3 49705.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:57.665 aoe F immolate enemy2 49252.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:58.972 aoe I rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
2:00.278 aoe L incinerate Fluffy_Pillow 49808.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
2:01.498 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
2:02.804 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:04.023 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.7/5: 34% soul_shard
2:05.764 aoe L incinerate Fluffy_Pillow 48635.5/50000: 97% mana
2.0/5: 40% soul_shard
2:07.504 default A cataclysm Fluffy_Pillow 48505.5/50000: 97% mana
2.5/5: 50% soul_shard
2:09.468 aoe J conflagrate Fluffy_Pillow 48987.5/50000: 98% mana
2.8/5: 56% soul_shard
2:10.774 aoe I rain_of_fire Fluffy_Pillow 49140.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
2:12.079 aoe H havoc enemy2 49793.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
2:13.384 havoc R incinerate Fluffy_Pillow 49445.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
2:14.603 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
2:16.344 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.7/5: 34% soul_shard
2:17.830 havoc Q chaos_bolt Fluffy_Pillow 49115.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:19.657 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
2:21.396 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.7/5: 34% soul_shard
2:23.137 havoc P immolate Fluffy_Pillow 48872.0/50000: 98% mana
2.4/5: 48% soul_shard
2:24.445 aoe E channel_demonfire Fluffy_Pillow 48776.0/50000: 98% mana
2.4/5: 48% soul_shard
2:27.163 default 9 soul_fire Fluffy_Pillow 49385.0/50000: 99% mana
3.0/5: 60% soul_shard
2:30.643 aoe F immolate enemy2 49003.5/50000: 98% mana
4.5/5: 90% soul_shard
2:31.952 aoe F immolate enemy3 48908.0/50000: 98% mana
4.5/5: 90% soul_shard
soothing_shade
2:33.257 aoe I rain_of_fire Fluffy_Pillow 48810.5/50000: 98% mana
4.8/5: 96% soul_shard
soothing_shade
2:34.565 aoe J conflagrate Fluffy_Pillow 49464.5/50000: 99% mana
1.9/5: 38% soul_shard
soothing_shade
2:35.871 aoe K impending_catastrophe Fluffy_Pillow 49617.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft, soothing_shade
2:37.613 aoe L incinerate Fluffy_Pillow 48003.0/50000: 96% mana
2.8/5: 56% soul_shard
backdraft, soothing_shade
2:38.831 aoe I rain_of_fire Fluffy_Pillow 47612.0/50000: 95% mana
3.3/5: 66% soul_shard
soothing_shade
2:40.138 default A cataclysm Fluffy_Pillow 48265.5/50000: 97% mana
0.4/5: 8% soul_shard
soothing_shade
2:41.878 aoe H havoc enemy2 48635.5/50000: 97% mana
0.6/5: 12% soul_shard
soothing_shade
2:43.386 havoc R incinerate Fluffy_Pillow 48389.5/50000: 97% mana
0.8/5: 16% soul_shard
soothing_shade
2:45.128 havoc N conflagrate Fluffy_Pillow 48260.5/50000: 97% mana
1.4/5: 28% soul_shard
2:46.434 havoc Q chaos_bolt Fluffy_Pillow 48413.5/50000: 97% mana
2.6/5: 52% soul_shard
backdraft
2:48.259 havoc N conflagrate Fluffy_Pillow 49326.0/50000: 99% mana
1.0/5: 20% soul_shard
2:49.564 havoc Q chaos_bolt Fluffy_Pillow 49478.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
2:51.392 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:52.700 aoe E channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
0.4/5: 8% soul_shard
2:55.508 aoe J conflagrate Fluffy_Pillow 49907.0/50000: 100% mana
0.8/5: 16% soul_shard
2:56.815 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
backdraft
2:58.034 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
2:59.775 aoe J conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
2.3/5: 46% soul_shard
3:01.081 aoe F immolate enemy3 49025.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:02.388 aoe I rain_of_fire Fluffy_Pillow 48929.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
3:03.695 aoe L incinerate Fluffy_Pillow 49582.5/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
3:04.913 cds M summon_infernal Fluffy_Pillow 49001.5/50000: 98% mana
0.6/5: 12% soul_shard
3:06.218 aoe F immolate Fluffy_Pillow 48654.0/50000: 97% mana
0.9/5: 18% soul_shard
3:07.524 aoe F immolate enemy2 48557.0/50000: 97% mana
1.4/5: 28% soul_shard
3:08.830 aoe J conflagrate Fluffy_Pillow 48460.0/50000: 97% mana
1.8/5: 36% soul_shard
3:10.136 aoe L incinerate Fluffy_Pillow 48613.0/50000: 97% mana
2.8/5: 56% soul_shard
backdraft
3:11.354 aoe D rain_of_fire Fluffy_Pillow 48222.0/50000: 96% mana
3.4/5: 68% soul_shard
3:12.660 default A cataclysm Fluffy_Pillow 48875.0/50000: 98% mana
0.9/5: 18% soul_shard
3:14.400 aoe E channel_demonfire Fluffy_Pillow 49245.0/50000: 98% mana
1.4/5: 28% soul_shard
soothing_shade
3:17.272 default 9 soul_fire Fluffy_Pillow 49931.0/50000: 100% mana
2.4/5: 48% soul_shard
soothing_shade
3:20.750 aoe H havoc enemy2 49002.5/50000: 98% mana
4.5/5: 90% soul_shard
soothing_shade
3:22.056 havoc Q chaos_bolt Fluffy_Pillow 48655.5/50000: 97% mana
5.0/5: 100% soul_shard
soothing_shade
3:24.665 havoc N conflagrate Fluffy_Pillow 49960.0/50000: 100% mana
3.0/5: 60% soul_shard
soothing_shade
3:25.972 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:27.798 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:29.105 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:30.933 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:32.240 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.3/5: 66% soul_shard
3:33.545 aoe F immolate enemy3 49905.0/50000: 100% mana
0.8/5: 16% soul_shard
3:34.853 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.1/5: 22% soul_shard
3:36.159 aoe E channel_demonfire Fluffy_Pillow 49406.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
3:39.011 aoe K impending_catastrophe Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
3:40.752 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
2.4/5: 48% soul_shard
backdraft
3:41.971 aoe L incinerate Fluffy_Pillow 47612.0/50000: 95% mana
2.7/5: 54% soul_shard
3:43.711 aoe I rain_of_fire Fluffy_Pillow 47482.0/50000: 95% mana
3.3/5: 66% soul_shard
3:45.017 default A cataclysm Fluffy_Pillow 48135.0/50000: 96% mana
0.4/5: 8% soul_shard
3:46.757 aoe J conflagrate Fluffy_Pillow 48505.0/50000: 97% mana
0.6/5: 12% soul_shard
3:48.063 aoe L incinerate Fluffy_Pillow 48658.0/50000: 97% mana
1.3/5: 26% soul_shard
backdraft
3:49.283 aoe L incinerate Fluffy_Pillow 48268.0/50000: 97% mana
1.6/5: 32% soul_shard
3:51.024 aoe H havoc enemy2 48138.5/50000: 96% mana
2.1/5: 42% soul_shard
3:52.330 havoc N conflagrate Fluffy_Pillow 47791.5/50000: 96% mana
2.2/5: 44% soul_shard
3:53.637 havoc Q chaos_bolt Fluffy_Pillow 47945.0/50000: 96% mana
3.5/5: 70% soul_shard
backdraft
3:55.465 havoc R incinerate Fluffy_Pillow 48859.0/50000: 98% mana
1.7/5: 34% soul_shard
3:57.206 havoc Q chaos_bolt Fluffy_Pillow 48729.5/50000: 97% mana
2.3/5: 46% soul_shard
3:59.815 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:01.122 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
4:02.863 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:04.170 aoe E channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:06.999 default 9 soul_fire Fluffy_Pillow 49820.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
4:10.477 aoe F immolate enemy3 49002.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft, soothing_shade
4:11.783 aoe F immolate Fluffy_Pillow 48905.5/50000: 98% mana
4.6/5: 92% soul_shard
backdraft, soothing_shade
4:13.091 aoe F immolate enemy2 48809.5/50000: 98% mana
4.6/5: 92% soul_shard
soothing_shade
4:14.397 aoe I rain_of_fire Fluffy_Pillow 48712.5/50000: 97% mana
4.9/5: 98% soul_shard
soothing_shade
4:15.703 aoe J conflagrate Fluffy_Pillow 49365.5/50000: 99% mana
1.9/5: 38% soul_shard
soothing_shade
4:17.009 default A cataclysm Fluffy_Pillow 49518.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, soothing_shade
4:18.748 aoe L incinerate Fluffy_Pillow 49501.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, soothing_shade
4:19.967 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
soothing_shade
4:21.273 aoe H havoc enemy2 49655.0/50000: 99% mana
0.3/5: 6% soul_shard
soothing_shade
4:22.580 havoc R incinerate Fluffy_Pillow 49308.5/50000: 99% mana
0.7/5: 14% soul_shard
4:24.317 havoc N conflagrate Fluffy_Pillow 49000.5/50000: 98% mana
1.2/5: 24% soul_shard
4:25.622 havoc Q chaos_bolt Fluffy_Pillow 49153.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:27.452 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:29.192 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
4:30.497 havoc P immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:31.804 havoc R incinerate Fluffy_Pillow 49058.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:33.024 aoe E channel_demonfire Fluffy_Pillow 48668.0/50000: 97% mana
3.1/5: 62% soul_shard
4:35.791 aoe I rain_of_fire Fluffy_Pillow 49301.5/50000: 99% mana
3.5/5: 70% soul_shard
4:37.097 aoe J conflagrate Fluffy_Pillow 49954.5/50000: 100% mana
0.6/5: 12% soul_shard
4:38.404 aoe F immolate enemy3 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
4:39.708 aoe L incinerate Fluffy_Pillow 49251.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
4:40.928 aoe K impending_catastrophe Fluffy_Pillow 48861.0/50000: 98% mana
1.8/5: 36% soul_shard
4:42.668 aoe L incinerate Fluffy_Pillow 47731.0/50000: 95% mana
2.0/5: 40% soul_shard
4:44.409 aoe J conflagrate Fluffy_Pillow 47601.5/50000: 95% mana
2.4/5: 48% soul_shard
4:45.716 aoe I rain_of_fire Fluffy_Pillow 47755.0/50000: 96% mana
3.2/5: 64% soul_shard
backdraft
4:47.022 aoe L incinerate Fluffy_Pillow 48408.0/50000: 97% mana
0.2/5: 4% soul_shard
backdraft
4:48.243 aoe L incinerate Fluffy_Pillow 48018.5/50000: 96% mana
0.6/5: 12% soul_shard
4:49.982 default A cataclysm Fluffy_Pillow 47888.0/50000: 96% mana
0.9/5: 18% soul_shard
4:51.722 aoe H havoc enemy2 48258.0/50000: 97% mana
1.2/5: 24% soul_shard
4:53.029 havoc N conflagrate Fluffy_Pillow 47911.5/50000: 96% mana
1.3/5: 26% soul_shard
4:54.335 havoc Q chaos_bolt Fluffy_Pillow 48064.5/50000: 96% mana
2.6/5: 52% soul_shard
backdraft
4:56.162 havoc O soul_fire Fluffy_Pillow 48978.0/50000: 98% mana
1.0/5: 20% soul_shard
4:59.640 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
3.4/5: 68% soul_shard
5:00.948 havoc N conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
3.6/5: 72% soul_shard
5:02.254 havoc R incinerate Fluffy_Pillow 49059.5/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
5:03.474 aoe E channel_demonfire Fluffy_Pillow 48669.5/50000: 97% mana
5.0/5: 100% soul_shard
soothing_shade
5:06.310 aoe I rain_of_fire Fluffy_Pillow 49337.5/50000: 99% mana
5.0/5: 100% soul_shard
soothing_shade
5:07.616 aoe L incinerate Fluffy_Pillow 49990.5/50000: 100% mana
2.1/5: 42% soul_shard
soothing_shade
5:09.358 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.7/5: 54% soul_shard
soothing_shade
5:10.814 aoe F immolate enemy3 49231.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, soothing_shade
5:12.121 aoe I rain_of_fire Fluffy_Pillow 49134.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, soothing_shade
5:13.428 aoe L incinerate Fluffy_Pillow 49788.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, soothing_shade
5:14.649 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
soothing_shade
5:16.390 aoe L incinerate Fluffy_Pillow 48873.5/50000: 98% mana
1.3/5: 26% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Theotar"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=336239/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

destruction : 9243 dps, 4976 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9243.4 9243.4 17.5 / 0.189% 754.1 / 8.2% 20.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
395.4 392.7 Mana 0.00% 38.2 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
destruction 9243
Cataclysm 772 8.4% 9.6 32.54sec 23992 14121 Direct 28.9 6704 13427 7998 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 28.90 0.00 0.00 1.6990 0.0000 231151.79 231151.79 0.00% 14121.31 14121.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 23.34 14 34 6703.76 6141 7261 6704.08 6509 6896 156498 156498 0.00%
crit 19.23% 5.56 1 13 13426.60 12284 14521 13417.75 12301 14234 74653 74653 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.70
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1029) 0.0% (11.1%) 12.3 25.22sec 25104 9311

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.28 0.00 183.32 0.00 2.6962 0.1636 0.00 0.00 0.00% 9311.29 9311.29

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.28
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1029 11.1% 0.0 0.00sec 0 0 Direct 550.0 470 942 560 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 549.97 0.00 0.00 0.0000 0.0000 308157.26 308157.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 444.38 318 568 469.66 263 976 469.99 450 494 208743 208743 0.00%
crit 19.20% 105.59 57 149 941.70 525 1952 941.87 822 1109 99414 99414 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1252 (1707) 13.5% (18.5%) 22.1 13.09sec 23122 11750 Direct 43.9 (87.3) 0 8524 8524 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.08 43.93 0.00 0.00 1.9679 0.0000 374517.35 374517.35 0.00% 11750.18 11750.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.93 32 58 8524.15 5861 11548 8523.98 8323 8708 374517 374517 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [P]:22.16
  • if_expr:cast_time<havoc_remains
    Internal Combustion 455 4.9% 43.4 13.09sec 3137 0 Direct 43.4 2629 5266 3140 19.3%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.39 43.39 0.00 0.00 0.0000 0.0000 136133.53 136133.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 35.01 23 51 2629.01 4 3715 2630.95 2433 2842 92031 92031 0.00%
crit 19.31% 8.38 1 16 5266.25 2 7430 5258.91 3777 6502 44103 44103 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 802 8.7% 37.0 7.96sec 6484 5188 Direct 56.0 3599 7181 4281 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.02 56.05 0.00 0.00 1.2498 0.0000 240040.24 240040.24 0.00% 5187.70 5187.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 45.34 31 60 3598.97 2047 5042 3599.62 3400 3816 163195 163195 0.00%
crit 19.10% 10.71 1 22 7180.84 4095 10083 7185.23 5188 8815 76845 76845 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.06
  • if_expr:buff.backdraft.down
    havoc
    [M]:18.96
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1612 17.5% 28.0 10.38sec 17239 13642 Direct 35.0 1533 3076 1825 18.9%
Periodic 346.4 1014 2028 1209 19.2% 95.6%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.00 35.00 346.41 346.41 1.2637 2.4819 482721.57 482721.57 0.00% 539.27 13642.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.08% 28.38 18 41 1533.22 819 2017 1533.84 1423 1652 43511 43511 0.00%
crit 18.92% 6.62 0 14 3076.05 1638 4033 3064.94 0 3884 20351 20351 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 279.73 208 349 1014.00 1 1261 1014.12 993 1037 283650 283650 0.00%
crit 19.25% 66.67 42 100 2027.69 3 2521 2027.70 1914 2130 135209 135209 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.60
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:8.51
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 608 6.6% 46.8 5.88sec 3898 2636 Direct 58.2 (58.2) 2626 5263 3138 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.82 58.20 0.00 0.00 1.4789 0.0000 182507.85 182507.85 0.00% 2635.99 2635.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 46.92 27 68 2626.17 1312 3232 2627.51 2431 2784 123218 123218 0.00%
crit 19.38% 11.28 3 22 5263.03 2625 6464 5251.01 4291 6051 59289 59289 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [K]:35.24
    havoc
    [Q]:11.88
  • if_expr:cast_time<havoc_remains
Rain of Fire 893 9.7% 17.1 16.86sec 15627 12569 Periodic 405.0 553 1105 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.09 0.00 0.00 404.97 1.2433 0.0000 267079.29 267079.29 0.00% 12569.03 12569.03
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 326.71 230 451 552.73 507 599 552.70 545 560 180570 180570 0.00%
crit 19.33% 78.27 50 121 1105.36 1013 1198 1105.31 1078 1124 86509 86509 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.15
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.95
Soul Fire 512 5.5% 5.6 49.54sec 27620 7943 Direct 7.5 17004 34019 20318 19.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.54 0.00 0.00 3.4775 0.0000 153343.19 153343.19 0.00% 7942.77 7942.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.41% 6.06 2 10 17003.61 8707 21177 17019.55 14252 19674 103060 103060 0.00%
crit 19.59% 1.48 0 5 34018.71 17226 42341 26322.43 0 42314 50283 50283 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.59
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [N]:1.05
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.9% 2.0 180.56sec 11992 10374 Direct 6.0 3348 6696 3998 19.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23984.24 23984.24 0.00% 10373.80 10373.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 4.84 1 6 3348.13 3348 3348 3348.13 3348 3348 16193 16193 0.00%
crit 19.39% 1.16 0 5 6696.27 6696 6696 4867.67 0 6696 7791 7791 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [L]:2.00
pet - infernal 3515 / 713
Immolation 3249 7.1% 39.0 5.49sec 4998 0 Direct 117.0 1395 2790 1666 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194940.33 194940.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 94.26 80 106 1395.06 1395 1395 1395.06 1395 1395 131503 131503 0.00%
crit 19.43% 22.74 11 37 2790.11 2790 2790 2790.11 2790 2790 63438 63438 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 390 19.6%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15965.20 22804.70 29.99% 271.04 271.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 32.96 25 39 325.55 326 326 325.55 326 326 10730 15327 29.99%
crit 19.61% 8.04 2 16 651.10 651 651 651.10 651 651 5235 7478 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.6% 93.2 3.21sec 1652 1135 Direct 92.5 1395 2790 1664 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.22 92.50 0.00 0.00 1.4559 0.0000 153973.97 153973.97 0.00% 1134.56 1134.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 74.62 56 95 1395.06 1395 1395 1395.06 1395 1395 104106 104106 0.00%
crit 19.32% 17.87 6 32 2790.11 2790 2790 2790.11 2790 2790 49868 49868 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.66
Simple Action Stats Execute Interval
destruction
Havoc 9.6 32.37sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.59 0.00 0.00 0.00 1.2439 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.59
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.1sec 50.93% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.5s
  • trigger_min/max:2.1s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.93%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.4s
  • trigger_min/max:180.0s / 185.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.4s
  • trigger_min/max:180.0s / 185.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.87% 9.94% 15.49% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
destruction
soul_fire Soul Shard 6.56 7.18 7.59% 1.09 0.43 5.64%
immolate Soul Shard 346.43 33.25 35.14% 0.10 1.39 4.02%
incinerate Soul Shard 46.85 11.73 12.39% 0.25 0.00 0.03%
conflagrate Soul Shard 37.01 28.02 29.61% 0.76 0.00 0.00%
mana_regen Mana 656.02 117708.96 100.00% 179.43 31846.55 21.29%
immolate_crits Soul Shard 33.47 3.21 3.39% 0.10 0.14 4.05%
incinerate_crits Soul Shard 11.30 1.13 1.19% 0.10 0.00 0.07%
infernal Soul Shard 120.00 10.11 10.68% 0.08 1.89 15.79%
pet - imp
energy_regen Energy 360.75 3557.55 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 392.69 395.41 31876.2 49184.1 47893.0 50000.0
Soul Shard 4.0 0.32 0.32 3.9 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
destruction
cataclysm Mana 9.6 4822.8 500.0 500.6 47.9
channel_demonfire Mana 12.3 9211.3 750.0 750.4 33.5
chaos_bolt Soul Shard 22.0 44.1 2.0 2.0 11583.1
conflagrate Mana 37.0 18506.5 500.0 499.9 13.0
havoc Mana 9.6 9591.4 1000.0 1000.5 0.0
immolate Mana 28.0 20986.0 750.0 749.4 23.0
incinerate Mana 46.8 46848.9 1000.0 1000.7 3.9
rain_of_fire Soul Shard 17.1 51.3 3.0 3.0 5203.7
soul_fire Mana 6.6 6561.6 1000.0 1181.9 23.4
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.2 3728.4 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
destruction Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
destruction Damage Per Second
Count 520
Mean 9243.40
Minimum 8793.59
Maximum 9859.29
Spread ( max - min ) 1065.70
Range [ ( max - min ) / 2 * 100% ] 5.76%
Standard Deviation 203.6675
5th Percentile 8926.94
95th Percentile 9577.82
( 95th Percentile - 5th Percentile ) 650.88
Mean Distribution
Standard Deviation 8.9314
95.00% Confidence Interval ( 9225.90 - 9260.91 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1865
0.1 Scale Factor Error with Delta=300 355
0.05 Scale Factor Error with Delta=300 1417
0.01 Scale Factor Error with Delta=300 35411
Priority Target DPS
destruction Priority Target Damage Per Second
Count 520
Mean 4976.17
Minimum 4635.80
Maximum 5340.44
Spread ( max - min ) 704.65
Range [ ( max - min ) / 2 * 100% ] 7.08%
Standard Deviation 117.2339
5th Percentile 4776.07
95th Percentile 5182.22
( 95th Percentile - 5th Percentile ) 406.14
Mean Distribution
Standard Deviation 5.1410
95.00% Confidence Interval ( 4966.09 - 4986.25 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2133
0.1 Scale Factor Error with Delta=300 118
0.05 Scale Factor Error with Delta=300 470
0.01 Scale Factor Error with Delta=300 11733
DPS(e)
destruction Damage Per Second (Effective)
Count 520
Mean 9243.40
Minimum 8793.59
Maximum 9859.29
Spread ( max - min ) 1065.70
Range [ ( max - min ) / 2 * 100% ] 5.76%
Damage
destruction Damage
Count 520
Mean 2399636.31
Minimum 1937643.13
Maximum 2864317.89
Spread ( max - min ) 926674.77
Range [ ( max - min ) / 2 * 100% ] 19.31%
DTPS
destruction Damage Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
destruction Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
destruction Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
destruction Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
destruction Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
destruction Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
destructionTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
destruction Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.59 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.70 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.15 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.28 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.60 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.59 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.95 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.06 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 35.24 incinerate
actions.cds
# count action,conditions
L 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
M 18.96 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
N 1.05 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
O 8.51 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
P 22.16 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
Q 11.88 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AELHPMPMOPMPMDEFFFDKJKKDJKAKJEHPPQMNFFIFJIEKJKAKKHMPPOQMEKFIJKKKK9AHPMPMPOMEIKKFFFJKIKJAHQPQMPO9EJFIKJKFKKAHMPPQMOEIKJKFLKKDJ9AEHPMPMOPDKJFKFEFIJKAKHMPQPOQM9EFIJKIKJAHQPQMPOEJKKKFFIJFKKKA9EHPMPMOPMFIK

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.929 cds L summon_infernal Fluffy_Pillow 49714.5/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.935 aoe H havoc enemy2 49217.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.942 havoc P chaos_bolt Fluffy_Pillow 48721.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.949 havoc M conflagrate Fluffy_Pillow 49724.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.956 havoc P chaos_bolt Fluffy_Pillow 49728.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.363 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.369 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.375 havoc P chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.780 havoc M conflagrate Fluffy_Pillow 49954.5/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.789 havoc P chaos_bolt Fluffy_Pillow 49959.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.196 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.202 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:18.208 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:20.717 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:21.723 aoe F immolate enemy2 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.730 aoe F immolate enemy3 49005.5/50000: 98% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.737 aoe D rain_of_fire Fluffy_Pillow 48759.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.743 aoe K incinerate Fluffy_Pillow 49262.0/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust, backdraft
0:25.682 aoe J conflagrate Fluffy_Pillow 48731.5/50000: 97% mana
0.8/5: 16% soul_shard
bloodlust
0:26.689 aoe K incinerate Fluffy_Pillow 48735.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:27.630 aoe K incinerate Fluffy_Pillow 48205.5/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:28.969 aoe D rain_of_fire Fluffy_Pillow 47875.0/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust
0:29.975 aoe J conflagrate Fluffy_Pillow 48378.0/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust
0:30.981 aoe K incinerate Fluffy_Pillow 48381.0/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:31.920 default A cataclysm Fluffy_Pillow 47850.5/50000: 96% mana
1.9/5: 38% soul_shard
bloodlust
0:33.261 aoe K incinerate Fluffy_Pillow 48021.0/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:34.601 aoe J conflagrate Fluffy_Pillow 47691.0/50000: 95% mana
2.9/5: 58% soul_shard
bloodlust
0:35.607 aoe E channel_demonfire Fluffy_Pillow 47694.0/50000: 95% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:37.877 aoe H havoc enemy2 48079.0/50000: 96% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:38.884 havoc P chaos_bolt Fluffy_Pillow 47582.5/50000: 95% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:40.291 havoc P chaos_bolt Fluffy_Pillow 48286.0/50000: 97% mana
2.5/5: 50% soul_shard
bloodlust
0:42.297 havoc Q incinerate Fluffy_Pillow 49289.0/50000: 99% mana
0.8/5: 16% soul_shard
0:44.038 havoc M conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
0:45.344 havoc N soul_fire Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
0:48.823 aoe F immolate enemy2 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:50.129 aoe F immolate Fluffy_Pillow 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.436 aoe I rain_of_fire Fluffy_Pillow 48809.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:52.743 aoe F immolate enemy3 49463.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
0:54.049 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
0:55.354 aoe I rain_of_fire Fluffy_Pillow 49404.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
0:56.660 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
0:59.509 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:00.729 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
1:02.037 aoe K incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
1:03.257 default A cataclysm Fluffy_Pillow 48766.5/50000: 98% mana
1.9/5: 38% soul_shard
1:04.997 aoe K incinerate Fluffy_Pillow 49136.5/50000: 98% mana
2.0/5: 40% soul_shard
1:06.736 aoe K incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.5/5: 50% soul_shard
1:08.477 aoe H havoc enemy2 48872.0/50000: 98% mana
2.9/5: 58% soul_shard
1:09.785 havoc M conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
3.0/5: 60% soul_shard
1:11.090 havoc P chaos_bolt Fluffy_Pillow 48678.5/50000: 97% mana
4.2/5: 84% soul_shard
backdraft
1:12.917 havoc P chaos_bolt Fluffy_Pillow 49592.0/50000: 99% mana
2.3/5: 46% soul_shard
1:15.526 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:16.832 havoc Q incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
1:18.573 havoc M conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:19.880 aoe E channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:22.729 aoe K incinerate Fluffy_Pillow 49830.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
1:23.949 aoe F immolate enemy3 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
1:25.256 aoe I rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
3.6/5: 72% soul_shard
1:26.562 aoe J conflagrate Fluffy_Pillow 49559.0/50000: 99% mana
0.8/5: 16% soul_shard
1:27.869 aoe K incinerate Fluffy_Pillow 49712.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
1:29.087 aoe K incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.8/5: 36% soul_shard
1:30.828 aoe K incinerate Fluffy_Pillow 48872.0/50000: 98% mana
2.2/5: 44% soul_shard
1:32.569 aoe K incinerate Fluffy_Pillow 48742.5/50000: 97% mana
2.8/5: 56% soul_shard
1:34.309 default 9 soul_fire Fluffy_Pillow 48612.5/50000: 97% mana
3.1/5: 62% soul_shard
1:37.786 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
4.6/5: 92% soul_shard
1:39.526 aoe H havoc enemy2 49372.0/50000: 99% mana
4.7/5: 94% soul_shard
1:40.833 havoc P chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
4.7/5: 94% soul_shard
1:43.443 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
1:44.750 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
1:46.576 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
1:47.884 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:49.713 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
1:51.020 havoc M conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.8/5: 36% soul_shard
1:52.327 aoe E channel_demonfire Fluffy_Pillow 49406.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
1:55.191 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:56.498 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:57.718 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
1:59.459 aoe F immolate enemy3 48873.0/50000: 98% mana
1.4/5: 28% soul_shard
2:00.767 aoe F immolate enemy2 48777.0/50000: 98% mana
1.6/5: 32% soul_shard
2:02.073 aoe F immolate Fluffy_Pillow 48680.0/50000: 97% mana
1.8/5: 36% soul_shard
2:03.378 aoe J conflagrate Fluffy_Pillow 48582.5/50000: 97% mana
2.0/5: 40% soul_shard
2:04.684 aoe K incinerate Fluffy_Pillow 48735.5/50000: 97% mana
2.6/5: 52% soul_shard
backdraft
2:05.903 aoe I rain_of_fire Fluffy_Pillow 48345.0/50000: 97% mana
3.0/5: 60% soul_shard
2:07.208 aoe K incinerate Fluffy_Pillow 48997.5/50000: 98% mana
0.1/5: 2% soul_shard
2:08.948 aoe J conflagrate Fluffy_Pillow 48867.5/50000: 98% mana
0.5/5: 10% soul_shard
2:10.255 default A cataclysm Fluffy_Pillow 49021.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
2:11.996 aoe H havoc enemy2 49391.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
2:13.302 havoc Q incinerate Fluffy_Pillow 49044.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
2:14.522 havoc P chaos_bolt Fluffy_Pillow 48654.5/50000: 97% mana
2.3/5: 46% soul_shard
2:17.131 havoc Q incinerate Fluffy_Pillow 49959.0/50000: 100% mana
0.6/5: 12% soul_shard
2:18.873 havoc M conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
2:20.181 havoc P chaos_bolt Fluffy_Pillow 49157.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:22.007 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:23.314 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
0.6/5: 12% soul_shard
2:26.792 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
2:29.554 aoe J conflagrate Fluffy_Pillow 49633.5/50000: 99% mana
2.4/5: 48% soul_shard
2:30.859 aoe F immolate enemy3 49786.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
2:32.165 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
2:33.472 aoe K incinerate Fluffy_Pillow 49905.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
2:34.692 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
2:35.998 aoe K incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:37.218 aoe F immolate enemy2 48765.5/50000: 98% mana
1.7/5: 34% soul_shard
2:38.523 aoe K incinerate Fluffy_Pillow 48668.0/50000: 97% mana
1.8/5: 36% soul_shard
2:40.264 aoe K incinerate Fluffy_Pillow 48538.5/50000: 97% mana
2.3/5: 46% soul_shard
2:42.002 default A cataclysm Fluffy_Pillow 48407.5/50000: 97% mana
2.9/5: 58% soul_shard
2:43.742 aoe H havoc enemy2 48777.5/50000: 98% mana
3.0/5: 60% soul_shard
2:45.050 havoc M conflagrate Fluffy_Pillow 48431.5/50000: 97% mana
3.2/5: 64% soul_shard
2:46.356 havoc P chaos_bolt Fluffy_Pillow 48584.5/50000: 97% mana
4.3/5: 86% soul_shard
backdraft
2:48.183 havoc P chaos_bolt Fluffy_Pillow 49498.0/50000: 99% mana
2.5/5: 50% soul_shard
2:50.791 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:52.532 havoc M conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
2:53.838 havoc O immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:55.146 aoe E channel_demonfire Fluffy_Pillow 49059.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:57.985 aoe I rain_of_fire Fluffy_Pillow 49729.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
2:59.291 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
3:00.511 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
3:01.817 aoe K incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
3:03.035 aoe F immolate enemy3 48764.5/50000: 98% mana
1.6/5: 32% soul_shard
3:04.341 cds L summon_infernal Fluffy_Pillow 48667.5/50000: 97% mana
1.7/5: 34% soul_shard
3:05.648 aoe K incinerate Fluffy_Pillow 48321.0/50000: 97% mana
2.2/5: 44% soul_shard
3:07.388 aoe K incinerate Fluffy_Pillow 48191.0/50000: 96% mana
2.9/5: 58% soul_shard
3:09.129 aoe D rain_of_fire Fluffy_Pillow 48061.5/50000: 96% mana
3.6/5: 72% soul_shard
3:10.434 aoe J conflagrate Fluffy_Pillow 48714.0/50000: 97% mana
1.1/5: 22% soul_shard
3:11.740 default 9 soul_fire Fluffy_Pillow 48867.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:15.262 default A cataclysm Fluffy_Pillow 49001.0/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
3:17.003 aoe E channel_demonfire Fluffy_Pillow 49371.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
3:19.775 aoe H havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
backdraft
3:21.082 havoc P chaos_bolt Fluffy_Pillow 49653.5/50000: 99% mana
5.0/5: 100% soul_shard
3:23.691 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:24.996 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:26.823 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:28.131 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:29.437 havoc P chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:31.265 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:32.570 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:34.310 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
3:35.617 aoe F immolate enemy3 49155.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
3:36.924 aoe K incinerate Fluffy_Pillow 49059.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
3:38.144 aoe F immolate enemy2 48669.0/50000: 97% mana
2.5/5: 50% soul_shard
3:39.450 aoe E channel_demonfire Fluffy_Pillow 48572.0/50000: 97% mana
2.6/5: 52% soul_shard
3:42.297 aoe F immolate Fluffy_Pillow 49245.5/50000: 98% mana
2.9/5: 58% soul_shard
3:43.603 aoe I rain_of_fire Fluffy_Pillow 49148.5/50000: 98% mana
3.3/5: 66% soul_shard
3:44.910 aoe J conflagrate Fluffy_Pillow 49802.0/50000: 100% mana
0.4/5: 8% soul_shard
3:46.215 aoe K incinerate Fluffy_Pillow 49954.5/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
3:47.433 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
1.5/5: 30% soul_shard
3:49.175 aoe K incinerate Fluffy_Pillow 49372.5/50000: 99% mana
1.7/5: 34% soul_shard
3:50.914 aoe H havoc enemy2 49001.5/50000: 98% mana
2.1/5: 42% soul_shard
3:52.220 havoc M conflagrate Fluffy_Pillow 48654.5/50000: 97% mana
2.3/5: 46% soul_shard
3:53.525 havoc P chaos_bolt Fluffy_Pillow 48807.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
3:55.352 havoc Q incinerate Fluffy_Pillow 49720.5/50000: 99% mana
1.6/5: 32% soul_shard
3:57.093 havoc P chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
3:59.703 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:01.010 havoc Q incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
4:02.751 havoc M conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
4:04.057 default 9 soul_fire Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:07.534 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.3/5: 86% soul_shard
backdraft
4:10.417 aoe F immolate enemy3 49693.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
4:11.724 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
4:13.030 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
2.0/5: 40% soul_shard
4:14.334 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
4:15.555 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.0/5: 60% soul_shard
4:16.861 aoe K incinerate Fluffy_Pillow 49656.0/50000: 99% mana
0.1/5: 2% soul_shard
4:18.602 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.5/5: 10% soul_shard
4:19.908 default A cataclysm Fluffy_Pillow 49155.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:21.649 aoe H havoc enemy2 49502.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
4:22.956 havoc Q incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
4:24.177 havoc P chaos_bolt Fluffy_Pillow 48766.5/50000: 98% mana
2.1/5: 42% soul_shard
4:26.786 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:28.526 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
4:29.832 havoc P chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:31.662 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:32.967 aoe E channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
0.7/5: 14% soul_shard
4:35.664 aoe J conflagrate Fluffy_Pillow 49850.0/50000: 100% mana
1.0/5: 20% soul_shard
4:36.970 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
4:38.190 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
4:39.929 aoe K incinerate Fluffy_Pillow 48872.0/50000: 98% mana
2.6/5: 52% soul_shard
4:41.668 aoe F immolate enemy3 48741.5/50000: 97% mana
3.1/5: 62% soul_shard
4:42.972 aoe F immolate enemy2 48643.5/50000: 97% mana
3.2/5: 64% soul_shard
4:44.279 aoe I rain_of_fire Fluffy_Pillow 48547.0/50000: 97% mana
3.5/5: 70% soul_shard
4:45.585 aoe J conflagrate Fluffy_Pillow 49200.0/50000: 98% mana
0.6/5: 12% soul_shard
4:46.890 aoe F immolate Fluffy_Pillow 49352.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
4:48.199 aoe K incinerate Fluffy_Pillow 49253.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
4:49.418 aoe K incinerate Fluffy_Pillow 48863.0/50000: 98% mana
1.9/5: 38% soul_shard
4:51.158 aoe K incinerate Fluffy_Pillow 48733.0/50000: 97% mana
2.2/5: 44% soul_shard
4:52.897 default A cataclysm Fluffy_Pillow 48602.5/50000: 97% mana
2.6/5: 52% soul_shard
4:54.637 default 9 soul_fire Fluffy_Pillow 48972.5/50000: 98% mana
3.0/5: 60% soul_shard
4:58.114 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.6/5: 92% soul_shard
5:00.910 aoe H havoc enemy2 49650.0/50000: 99% mana
4.9/5: 98% soul_shard
5:02.217 havoc P chaos_bolt Fluffy_Pillow 49303.5/50000: 99% mana
5.0/5: 100% soul_shard
5:04.828 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:06.134 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
5:07.962 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
5:09.270 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
5:10.576 havoc P chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
5:12.404 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
5:13.710 aoe F immolate enemy3 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
5:15.017 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
5:16.326 aoe K incinerate Fluffy_Pillow 49907.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="destruction"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Simulation & Raid Information

Iterations: 536
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 241 - 360 ( 299.7 )

Performance:

Total Events Processed: 14127983
Max Event Queue: 351
Sim Seconds: 160622
CPU Seconds: 25.1875
Physical Seconds: 1.7673
Speed Up: 6377

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite cataclysm 152108 233663 780 5.82 6707 13410 9.7 29.1 19.9% 0.0% 0.0% 0.0% 32.37sec 233663 299.67sec
Kyrian_Forgelite Kyrian_Forgelite channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 25.76sec 0 299.67sec
Kyrian_Forgelite Kyrian_Forgelite channel_demonfire_tick 196448 299503 999 107.15 469 938 0.0 535.2 19.3% 0.0% 0.0% 0.0% 0.00sec 299503 299.67sec
Kyrian_Forgelite Kyrian_Forgelite chaos_bolt 116858 337436 1126 7.48 0 9029 18.8 37.4 100.0% 0.0% 0.0% 0.0% 15.47sec 337436 299.67sec
Kyrian_Forgelite Kyrian_Forgelite internal_combustion 266134 110782 370 7.27 2554 5101 36.3 36.3 19.5% 0.0% 0.0% 0.0% 15.45sec 110782 299.67sec
Kyrian_Forgelite Kyrian_Forgelite conflagrate 17962 237265 792 11.00 3614 7255 36.8 54.9 19.3% 0.0% 0.0% 0.0% 7.94sec 237265 299.67sec
Kyrian_Forgelite Kyrian_Forgelite havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.23sec 0 299.67sec
Kyrian_Forgelite Kyrian_Forgelite immolate 348 56878 190 6.31 1516 3026 25.3 31.5 19.1% 0.0% 0.0% 0.0% 11.44sec 475900 299.67sec
Kyrian_Forgelite Kyrian_Forgelite immolate ticks -348 419022 1397 69.19 1015 2031 25.3 345.9 19.3% 0.0% 0.0% 0.0% 11.44sec 475900 299.67sec
Kyrian_Forgelite Kyrian_Forgelite incinerate 29722 165956 554 10.02 2781 5564 39.4 50.0 19.2% 0.0% 0.0% 0.0% 7.11sec 165956 299.67sec
Kyrian_Forgelite Kyrian_Forgelite rain_of_fire ticks -5740 288662 962 0.00 553 1106 18.4 0.0 19.2% 0.0% 0.0% 0.0% 15.58sec 288662 299.67sec
Kyrian_Forgelite Kyrian_Forgelite scouring_tithe 312321 33331 111 3.75 1484 2964 13.4 18.7 20.1% 0.0% 0.0% 0.0% 22.65sec 98727 299.67sec
Kyrian_Forgelite Kyrian_Forgelite scouring_tithe ticks -312321 65396 218 26.58 413 826 13.4 132.9 19.1% 0.0% 0.0% 0.0% 22.65sec 98727 299.67sec
Kyrian_Forgelite Kyrian_Forgelite soul_fire 6353 144510 482 1.48 16295 32800 5.5 7.4 19.6% 0.0% 0.0% 0.0% 49.45sec 144510 299.67sec
Kyrian_Forgelite Kyrian_Forgelite summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
Kyrian_Forgelite Kyrian_Forgelite summon_infernal 1122 23656 79 1.20 3348 6696 2.0 6.0 17.8% 0.0% 0.0% 0.0% 180.44sec 23656 299.67sec
Kyrian_Forgelite Kyrian_Forgelite_infernal immolation 20153 194887 3248 117.00 1395 2790 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 194887 60.00sec
Kyrian_Forgelite Kyrian_Forgelite_infernal melee 0 15823 264 41.00 326 651 41.0 41.0 18.5% 0.0% 0.0% 0.0% 5.25sec 22602 60.00sec
Kyrian_Forgelite Kyrian_Forgelite_imp firebolt 3110 154143 514 18.52 1395 2790 93.2 92.5 19.5% 0.0% 0.0% 0.0% 3.21sec 154143 299.67sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 8.00sec 0 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 4.00sec 0 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 1841 61 18.00 172 343 9.0 9.0 19.1% 0.0% 0.0% 0.0% 2.88sec 2630 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 8.17sec 0 30.00sec
Kyrian_Pelagos Kyrian_Pelagos cataclysm 152108 235219 785 5.83 6764 13534 9.7 29.1 19.5% 0.0% 0.0% 0.0% 32.30sec 235219 299.67sec
Kyrian_Pelagos Kyrian_Pelagos channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 26.09sec 0 299.67sec
Kyrian_Pelagos Kyrian_Pelagos channel_demonfire_tick 196448 309771 1034 106.51 488 975 0.0 532.0 19.3% 0.0% 0.0% 0.0% 0.00sec 309771 299.67sec
Kyrian_Pelagos Kyrian_Pelagos chaos_bolt 116858 353953 1181 7.50 0 9448 18.8 37.5 100.0% 0.0% 0.0% 0.0% 15.45sec 353953 299.67sec
Kyrian_Pelagos Kyrian_Pelagos internal_combustion 266134 116734 390 7.32 2674 5355 36.6 36.6 19.4% 0.0% 0.0% 0.0% 15.49sec 116734 299.67sec
Kyrian_Pelagos Kyrian_Pelagos conflagrate 17962 245952 821 10.97 3763 7510 36.8 54.8 19.4% 0.0% 0.0% 0.0% 7.95sec 245952 299.67sec
Kyrian_Pelagos Kyrian_Pelagos havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.09sec 0 299.67sec
Kyrian_Pelagos Kyrian_Pelagos immolate 348 60086 201 6.33 1592 3178 25.4 31.6 19.5% 0.0% 0.0% 0.0% 11.35sec 494144 299.67sec
Kyrian_Pelagos Kyrian_Pelagos immolate ticks -348 434058 1447 69.31 1050 2100 25.4 346.6 19.3% 0.0% 0.0% 0.0% 11.35sec 494144 299.67sec
Kyrian_Pelagos Kyrian_Pelagos incinerate 29722 171799 573 10.01 2880 5770 39.4 50.0 19.2% 0.0% 0.0% 0.0% 7.16sec 171799 299.67sec
Kyrian_Pelagos Kyrian_Pelagos rain_of_fire ticks -5740 298994 997 0.00 572 1146 18.4 0.0 19.3% 0.0% 0.0% 0.0% 15.50sec 298994 299.67sec
Kyrian_Pelagos Kyrian_Pelagos scouring_tithe 312321 33458 112 3.77 1481 2979 13.4 18.8 19.8% 0.0% 0.0% 0.0% 22.48sec 99355 299.67sec
Kyrian_Pelagos Kyrian_Pelagos scouring_tithe ticks -312321 65897 220 26.75 413 826 13.4 133.8 19.2% 0.0% 0.0% 0.0% 22.48sec 99355 299.67sec
Kyrian_Pelagos Kyrian_Pelagos soul_fire 6353 145271 485 1.48 16520 33178 5.5 7.4 18.6% 0.0% 0.0% 0.0% 49.45sec 145271 299.67sec
Kyrian_Pelagos Kyrian_Pelagos summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
Kyrian_Pelagos Kyrian_Pelagos summon_infernal 1122 23907 80 1.20 3348 6696 2.0 6.0 19.0% 0.0% 0.0% 0.0% 180.70sec 23907 299.67sec
Kyrian_Pelagos Kyrian_Pelagos_infernal immolation 20153 213480 3558 117.00 1528 3066 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.50sec 213480 60.00sec
Kyrian_Pelagos Kyrian_Pelagos_infernal melee 0 16006 267 41.00 326 651 41.0 41.0 19.9% 0.0% 0.0% 0.0% 5.26sec 22863 60.00sec
Kyrian_Pelagos Kyrian_Pelagos_imp firebolt 3110 154266 515 18.52 1395 2790 93.2 92.5 19.5% 0.0% 0.0% 0.0% 3.21sec 154266 299.67sec
Necrolord_Emeni Necrolord_Emeni cataclysm 152108 236004 788 5.80 6812 13640 9.7 29.0 19.5% 0.0% 0.0% 0.0% 32.46sec 236004 299.67sec
Necrolord_Emeni Necrolord_Emeni channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.70sec 0 299.67sec
Necrolord_Emeni Necrolord_Emeni channel_demonfire_tick 196448 312157 1042 108.47 483 967 0.0 541.7 19.2% 0.0% 0.0% 0.0% 0.00sec 312157 299.67sec
Necrolord_Emeni Necrolord_Emeni chaos_bolt 116858 360001 1201 7.62 0 9452 19.1 38.1 100.0% 0.0% 0.0% 0.0% 15.26sec 360001 299.67sec
Necrolord_Emeni Necrolord_Emeni internal_combustion 266134 118258 395 7.46 2663 5299 37.3 37.3 19.2% 0.0% 0.0% 0.0% 15.32sec 118258 299.67sec
Necrolord_Emeni Necrolord_Emeni conflagrate 17962 246942 824 11.05 3747 7492 36.7 55.2 19.4% 0.0% 0.0% 0.0% 7.96sec 246942 299.67sec
Necrolord_Emeni Necrolord_Emeni decimating_bolt 325289 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 49.38sec 0 299.67sec
Necrolord_Emeni Necrolord_Emeni decimating_bolt_tick_t 327059 56354 188 7.81 1209 2424 0.0 39.0 19.3% 0.0% 0.0% 0.0% 0.00sec 56354 299.67sec
Necrolord_Emeni Necrolord_Emeni havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.20sec 0 299.67sec
Necrolord_Emeni Necrolord_Emeni immolate 348 59767 199 6.48 1544 3116 25.9 32.4 19.2% 0.0% 0.0% 0.0% 11.22sec 492976 299.67sec
Necrolord_Emeni Necrolord_Emeni immolate ticks -348 433209 1444 69.69 1042 2083 25.9 348.5 19.4% 0.0% 0.0% 0.0% 11.22sec 492976 299.67sec
Necrolord_Emeni Necrolord_Emeni incinerate 29722 282012 941 10.86 4344 8721 43.3 54.2 19.6% 0.0% 0.0% 0.0% 6.37sec 282012 299.67sec
Necrolord_Emeni Necrolord_Emeni rain_of_fire ticks -5740 295142 984 0.00 564 1129 18.5 0.0 19.1% 0.0% 0.0% 0.0% 15.57sec 295142 299.67sec
Necrolord_Emeni Necrolord_Emeni soul_fire 6353 148227 495 1.57 15898 31924 5.6 7.9 18.5% 0.0% 0.0% 0.0% 49.56sec 148227 299.67sec
Necrolord_Emeni Necrolord_Emeni summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
Necrolord_Emeni Necrolord_Emeni summon_infernal 1122 23868 80 1.20 3348 6696 2.0 6.0 18.8% 0.0% 0.0% 0.0% 180.63sec 23868 299.67sec
Necrolord_Emeni Necrolord_Emeni_infernal immolation 20153 202605 3377 117.00 1450 2904 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.50sec 202605 60.00sec
Necrolord_Emeni Necrolord_Emeni_infernal melee 0 16427 274 41.00 338 675 41.0 41.0 18.6% 0.0% 0.0% 0.0% 5.25sec 23464 60.00sec
Necrolord_Emeni Necrolord_Emeni_imp firebolt 3110 157600 526 18.52 1427 2851 93.2 92.5 19.5% 0.0% 0.0% 0.0% 3.21sec 157600 299.67sec
Necrolord_Marileth Necrolord_Marileth cataclysm 152108 231629 773 5.79 6699 13393 9.6 28.9 19.5% 0.0% 0.0% 0.0% 32.49sec 231629 299.67sec
Necrolord_Marileth Necrolord_Marileth channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.69sec 0 299.67sec
Necrolord_Marileth Necrolord_Marileth channel_demonfire_tick 196448 304034 1015 108.22 472 943 0.0 540.5 19.3% 0.0% 0.0% 0.0% 0.00sec 304034 299.67sec
Necrolord_Marileth Necrolord_Marileth chaos_bolt 116858 403594 1347 8.94 0 9037 22.4 44.7 100.0% 0.0% 0.0% 0.0% 13.18sec 403594 299.67sec
Necrolord_Marileth Necrolord_Marileth internal_combustion 266134 138650 463 8.85 2629 5274 44.2 44.2 19.2% 0.0% 0.0% 0.0% 13.13sec 138650 299.67sec
Necrolord_Marileth Necrolord_Marileth conflagrate 17962 245689 820 11.41 3604 7234 37.0 57.0 19.5% 0.0% 0.0% 0.0% 7.96sec 245689 299.67sec
Necrolord_Marileth Necrolord_Marileth decimating_bolt 325289 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.45sec 0 299.67sec
Necrolord_Marileth Necrolord_Marileth decimating_bolt_tick_t 327059 29981 100 3.99 1257 2514 0.0 19.9 19.6% 0.0% 0.0% 0.0% 0.00sec 29981 299.67sec
Necrolord_Marileth Necrolord_Marileth havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.32sec 0 299.67sec
Necrolord_Marileth Necrolord_Marileth immolate 348 63285 211 6.91 1540 3064 27.0 34.5 19.2% 0.0% 0.0% 0.0% 10.80sec 481415 299.67sec
Necrolord_Marileth Necrolord_Marileth immolate ticks -348 418130 1394 69.14 1014 2027 27.0 345.7 19.3% 0.0% 0.0% 0.0% 10.80sec 481415 299.67sec
Necrolord_Marileth Necrolord_Marileth incinerate 29722 244136 815 10.11 4033 8150 40.8 50.5 19.6% 0.0% 0.0% 0.0% 6.64sec 244136 299.67sec
Necrolord_Marileth Necrolord_Marileth rain_of_fire ticks -5740 259612 865 0.00 553 1105 16.6 0.0 19.3% 0.0% 0.0% 0.0% 16.86sec 259612 299.67sec
Necrolord_Marileth Necrolord_Marileth soul_fire 6353 151167 504 1.50 17083 34001 5.6 7.5 18.2% 0.0% 0.0% 0.0% 49.31sec 151167 299.67sec
Necrolord_Marileth Necrolord_Marileth summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
Necrolord_Marileth Necrolord_Marileth summon_infernal 1122 23971 80 1.20 3348 6696 2.0 6.0 19.3% 0.0% 0.0% 0.0% 180.53sec 23971 299.67sec
Necrolord_Marileth Necrolord_Marileth_infernal immolation 20153 213538 3559 117.00 1529 3061 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.49sec 213538 60.00sec
Necrolord_Marileth Necrolord_Marileth_infernal melee 0 15907 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.25sec 22722 60.00sec
Necrolord_Marileth Necrolord_Marileth_imp firebolt 3110 153883 514 18.52 1395 2790 93.2 92.5 19.3% 0.0% 0.0% 0.0% 3.21sec 153883 299.67sec
NightFae_Dream NightFae_Dream cataclysm 152108 231760 773 5.82 6705 13392 9.7 29.1 19.0% 0.0% 0.0% 0.0% 32.43sec 231760 299.67sec
NightFae_Dream NightFae_Dream channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.55sec 0 299.67sec
NightFae_Dream NightFae_Dream channel_demonfire_tick 196448 306136 1022 108.02 476 951 0.0 539.5 19.3% 0.0% 0.0% 0.0% 0.00sec 306136 299.67sec
NightFae_Dream NightFae_Dream chaos_bolt 116858 390036 1302 8.64 0 9036 21.7 43.2 100.0% 0.0% 0.0% 0.0% 13.13sec 390036 299.67sec
NightFae_Dream NightFae_Dream internal_combustion 266134 133662 446 8.58 2622 5241 42.8 42.8 19.0% 0.0% 0.0% 0.0% 13.13sec 133662 299.67sec
NightFae_Dream NightFae_Dream conflagrate 17962 242307 809 11.33 3589 7141 36.9 56.6 19.5% 0.0% 0.0% 0.0% 7.94sec 242307 299.67sec
NightFae_Dream NightFae_Dream havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.02sec 0 299.67sec
NightFae_Dream NightFae_Dream immolate 348 61711 206 6.79 1526 3043 26.6 33.9 19.5% 0.0% 0.0% 0.0% 10.87sec 481176 299.67sec
NightFae_Dream NightFae_Dream immolate ticks -348 419465 1398 69.39 1014 2026 26.6 347.0 19.2% 0.0% 0.0% 0.0% 10.87sec 481176 299.67sec
NightFae_Dream NightFae_Dream incinerate 29722 184492 616 11.05 2800 5572 44.7 55.2 19.6% 0.0% 0.0% 0.0% 6.15sec 184492 299.67sec
NightFae_Dream NightFae_Dream rain_of_fire ticks -5740 272427 908 0.00 553 1106 17.4 0.0 19.2% 0.0% 0.0% 0.0% 16.79sec 272427 299.67sec
NightFae_Dream NightFae_Dream soul_fire 6353 151473 505 1.56 16410 33047 5.5 7.8 18.5% 0.0% 0.0% 0.0% 49.38sec 151473 299.67sec
NightFae_Dream NightFae_Dream soul_rot ticks -325640 101813 339 19.35 883 1765 5.3 96.8 19.2% 0.0% 0.0% 0.0% 62.41sec 101813 299.67sec
NightFae_Dream NightFae_Dream summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
NightFae_Dream NightFae_Dream summon_infernal 1122 24042 80 1.20 3348 6696 2.0 6.0 19.7% 0.0% 0.0% 0.0% 180.60sec 24042 299.67sec
NightFae_Dream NightFae_Dream_infernal immolation 20153 213932 3565 117.00 1529 3063 39.0 117.0 19.5% 0.0% 0.0% 0.0% 5.49sec 213932 60.00sec
NightFae_Dream NightFae_Dream_infernal melee 0 15927 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.25sec 22750 60.00sec
NightFae_Dream NightFae_Dream_imp firebolt 3110 153974 514 18.52 1395 2790 93.2 92.5 19.3% 0.0% 0.0% 0.0% 3.21sec 153974 299.67sec
NightFae_Dream_SB NightFae_Dream_SB cataclysm 152108 235468 786 5.81 6802 13617 9.7 29.0 19.3% 0.0% 0.0% 0.0% 32.32sec 235468 299.67sec
NightFae_Dream_SB NightFae_Dream_SB channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 26.19sec 0 299.67sec
NightFae_Dream_SB NightFae_Dream_SB channel_demonfire_tick 196448 310104 1035 107.62 484 965 0.0 537.5 19.3% 0.0% 0.0% 0.0% 0.00sec 310104 299.67sec
NightFae_Dream_SB NightFae_Dream_SB chaos_bolt 116858 394453 1316 8.62 0 9166 21.6 43.0 100.0% 0.0% 0.0% 0.0% 13.45sec 394453 299.67sec
NightFae_Dream_SB NightFae_Dream_SB internal_combustion 266134 136592 456 8.55 2681 5391 42.7 42.7 19.1% 0.0% 0.0% 0.0% 13.44sec 136592 299.67sec
NightFae_Dream_SB NightFae_Dream_SB conflagrate 17962 245601 820 11.34 3631 7276 36.9 56.6 19.4% 0.0% 0.0% 0.0% 7.94sec 245601 299.67sec
NightFae_Dream_SB NightFae_Dream_SB havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 31.95sec 0 299.67sec
NightFae_Dream_SB NightFae_Dream_SB immolate 348 62655 209 6.78 1551 3110 26.7 33.8 19.3% 0.0% 0.0% 0.0% 10.83sec 488210 299.67sec
NightFae_Dream_SB NightFae_Dream_SB immolate ticks -348 425555 1419 69.40 1027 2053 26.7 347.0 19.4% 0.0% 0.0% 0.0% 10.83sec 488210 299.67sec
NightFae_Dream_SB NightFae_Dream_SB incinerate 29722 186662 623 11.08 2833 5642 44.7 55.3 19.2% 0.0% 0.0% 0.0% 6.10sec 186662 299.67sec
NightFae_Dream_SB NightFae_Dream_SB rain_of_fire ticks -5740 277532 925 0.00 560 1121 17.5 0.0 19.4% 0.0% 0.0% 0.0% 16.10sec 277532 299.67sec
NightFae_Dream_SB NightFae_Dream_SB soul_fire 6353 155111 518 1.57 16590 32975 5.6 7.9 19.2% 0.0% 0.0% 0.0% 49.36sec 155111 299.67sec
NightFae_Dream_SB NightFae_Dream_SB soul_rot ticks -325640 103270 344 19.34 895 1780 5.3 96.7 19.5% 0.0% 0.0% 0.0% 62.37sec 103270 299.67sec
NightFae_Dream_SB NightFae_Dream_SB summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
NightFae_Dream_SB NightFae_Dream_SB summon_infernal 1122 24040 80 1.20 3377 6753 2.0 6.0 18.7% 0.0% 0.0% 0.0% 180.62sec 24040 299.67sec
NightFae_Dream_SB NightFae_Dream_SB_infernal immolation 20153 197119 3285 117.00 1414 2828 39.0 117.0 19.1% 0.0% 0.0% 0.0% 5.49sec 197119 60.00sec
NightFae_Dream_SB NightFae_Dream_SB_infernal melee 0 16087 268 41.00 330 660 41.0 41.0 18.9% 0.0% 0.0% 0.0% 5.25sec 22979 60.00sec
NightFae_Dream_SB NightFae_Dream_SB_imp firebolt 3110 155852 520 18.52 1414 2828 93.2 92.5 19.2% 0.0% 0.0% 0.0% 3.21sec 155852 299.67sec
NightFae_Koraylon NightFae_Koraylon cataclysm 152108 238862 797 5.81 6897 13795 9.7 29.0 19.3% 0.0% 0.0% 0.0% 32.39sec 238862 299.67sec
NightFae_Koraylon NightFae_Koraylon channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.51sec 0 299.67sec
NightFae_Koraylon NightFae_Koraylon channel_demonfire_tick 196448 317540 1060 108.29 493 986 0.0 540.9 19.1% 0.0% 0.0% 0.0% 0.00sec 317540 299.67sec
NightFae_Koraylon NightFae_Koraylon chaos_bolt 116858 399874 1334 8.59 0 9321 21.6 42.9 100.0% 0.0% 0.0% 0.0% 13.43sec 399874 299.67sec
NightFae_Koraylon NightFae_Koraylon internal_combustion 266134 142386 475 8.53 2813 5588 42.6 42.6 19.0% 0.0% 0.0% 0.0% 13.44sec 142386 299.67sec
NightFae_Koraylon NightFae_Koraylon conflagrate 17962 249396 832 11.35 3695 7396 36.9 56.7 19.1% 0.0% 0.0% 0.0% 7.95sec 249396 299.67sec
NightFae_Koraylon NightFae_Koraylon havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.06sec 0 299.67sec
NightFae_Koraylon NightFae_Koraylon immolate 348 63447 212 6.79 1568 3138 26.7 33.9 19.4% 0.0% 0.0% 0.0% 10.77sec 494305 299.67sec
NightFae_Koraylon NightFae_Koraylon immolate ticks -348 430858 1436 69.39 1042 2085 26.7 346.9 19.2% 0.0% 0.0% 0.0% 10.77sec 494305 299.67sec
NightFae_Koraylon NightFae_Koraylon incinerate 29722 188745 630 11.07 2851 5736 44.7 55.3 19.5% 0.0% 0.0% 0.0% 6.16sec 188745 299.67sec
NightFae_Koraylon NightFae_Koraylon rain_of_fire ticks -5740 282829 943 0.00 570 1140 17.5 0.0 19.3% 0.0% 0.0% 0.0% 16.30sec 282829 299.67sec
NightFae_Koraylon NightFae_Koraylon soul_fire 6353 159260 531 1.57 17029 33790 5.6 7.9 19.4% 0.0% 0.0% 0.0% 49.44sec 159260 299.67sec
NightFae_Koraylon NightFae_Koraylon soul_rot ticks -325640 105458 352 19.33 914 1834 5.3 96.6 19.3% 0.0% 0.0% 0.0% 62.61sec 105458 299.67sec
NightFae_Koraylon NightFae_Koraylon summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
NightFae_Koraylon NightFae_Koraylon summon_infernal 1122 25021 83 1.20 3514 7042 2.0 6.0 18.6% 0.0% 0.0% 0.0% 180.52sec 25021 299.67sec
NightFae_Koraylon NightFae_Koraylon_infernal immolation 20153 194621 3244 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 194621 60.00sec
NightFae_Koraylon NightFae_Koraylon_infernal melee 0 15894 265 41.00 326 651 41.0 41.0 19.1% 0.0% 0.0% 0.0% 5.25sec 22703 60.00sec
NightFae_Koraylon NightFae_Koraylon_imp firebolt 3110 154189 515 18.52 1395 2790 93.2 92.5 19.5% 0.0% 0.0% 0.0% 3.21sec 154189 299.67sec
NightFae_Niya NightFae_Niya cataclysm 152108 240036 801 5.82 6882 13803 9.7 29.1 19.9% 0.0% 0.0% 0.0% 32.25sec 240036 299.67sec
NightFae_Niya NightFae_Niya channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.82sec 0 299.67sec
NightFae_Niya NightFae_Niya channel_demonfire_tick 196448 318366 1062 107.54 497 996 0.0 537.1 19.3% 0.0% 0.0% 0.0% 0.00sec 318366 299.67sec
NightFae_Niya NightFae_Niya chaos_bolt 116858 404748 1351 8.58 0 9444 21.5 42.9 100.0% 0.0% 0.0% 0.0% 13.73sec 404748 299.67sec
NightFae_Niya NightFae_Niya internal_combustion 266134 138893 463 8.52 2746 5499 42.6 42.6 18.8% 0.0% 0.0% 0.0% 13.74sec 138893 299.67sec
NightFae_Niya NightFae_Niya conflagrate 17962 252337 842 11.34 3738 7475 36.9 56.6 19.2% 0.0% 0.0% 0.0% 7.93sec 252337 299.67sec
NightFae_Niya NightFae_Niya havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 31.94sec 0 299.67sec
NightFae_Niya NightFae_Niya immolate 348 64198 214 6.76 1600 3192 26.6 33.8 18.9% 0.0% 0.0% 0.0% 10.90sec 500978 299.67sec
NightFae_Niya NightFae_Niya immolate ticks -348 436781 1456 69.40 1056 2112 26.6 347.0 19.2% 0.0% 0.0% 0.0% 10.90sec 500978 299.67sec
NightFae_Niya NightFae_Niya incinerate 29722 192500 642 11.13 2900 5811 44.8 55.6 19.3% 0.0% 0.0% 0.0% 6.06sec 192500 299.67sec
NightFae_Niya NightFae_Niya rain_of_fire ticks -5740 286956 957 0.00 576 1152 17.6 0.0 19.4% 0.0% 0.0% 0.0% 15.75sec 286956 299.67sec
NightFae_Niya NightFae_Niya soul_fire 6353 156381 522 1.57 16790 33415 5.6 7.9 18.7% 0.0% 0.0% 0.0% 49.32sec 156381 299.67sec
NightFae_Niya NightFae_Niya soul_rot ticks -325640 101904 340 19.34 882 1771 5.3 96.7 19.3% 0.0% 0.0% 0.0% 62.49sec 101904 299.67sec
NightFae_Niya NightFae_Niya summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
NightFae_Niya NightFae_Niya summon_infernal 1122 24152 81 1.20 3348 6696 2.0 6.0 20.2% 0.0% 0.0% 0.0% 180.39sec 24152 299.67sec
NightFae_Niya NightFae_Niya_infernal immolation 20153 213187 3553 117.00 1529 3056 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 213187 60.00sec
NightFae_Niya NightFae_Niya_infernal melee 0 15990 266 41.00 326 651 41.0 41.0 19.8% 0.0% 0.0% 0.0% 5.25sec 22840 60.00sec
NightFae_Niya NightFae_Niya_imp firebolt 3110 153706 513 18.52 1395 2790 93.2 92.5 19.1% 0.0% 0.0% 0.0% 3.21sec 153706 299.67sec
Venthyr_Nadjia Venthyr_Nadjia cataclysm 152108 232344 775 5.82 6704 13399 9.7 29.1 19.2% 0.0% 0.0% 0.0% 32.37sec 232344 299.67sec
Venthyr_Nadjia Venthyr_Nadjia channel_demonfire 196447 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 24.07sec 0 299.67sec
Venthyr_Nadjia Venthyr_Nadjia channel_demonfire_tick 196448 323559 1080 115.41 470 943 0.0 576.4 19.2% 0.0% 0.0% 0.0% 0.00sec 323559 299.67sec
Venthyr_Nadjia Venthyr_Nadjia chaos_bolt 116858 409093 1365 9.07 0 9032 22.8 45.3 100.0% 0.0% 0.0% 0.0% 12.70sec 409093 299.67sec
Venthyr_Nadjia Venthyr_Nadjia internal_combustion 266134 144123 481 8.97 2699 5382 44.8 44.8 19.4% 0.0% 0.0% 0.0% 12.67sec 144123 299.67sec
Venthyr_Nadjia Venthyr_Nadjia conflagrate 17962 245849 820 11.34 3636 7272 37.9 56.6 19.4% 0.0% 0.0% 0.0% 7.79sec 245849 299.67sec
Venthyr_Nadjia Venthyr_Nadjia havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.25sec 0 299.67sec
Venthyr_Nadjia Venthyr_Nadjia immolate 348 65211 218 7.11 1540 3072 28.2 35.5 19.3% 0.0% 0.0% 0.0% 10.27sec 494487 299.67sec
Venthyr_Nadjia Venthyr_Nadjia immolate ticks -348 429276 1431 71.08 1012 2026 28.2 355.4 19.3% 0.0% 0.0% 0.0% 10.27sec 494487 299.67sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 65.01sec 0 299.67sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe_impact 322167 9216 31 2.77 558 1116 0.0 13.8 19.5% 0.0% 0.0% 0.0% 0.00sec 9216 299.67sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe_dot ticks -322170 60132 200 21.20 475 953 0.0 106.0 19.2% 0.0% 0.0% 0.0% 0.00sec 60132 299.67sec
Venthyr_Nadjia Venthyr_Nadjia incinerate 29722 179294 598 10.86 2773 5533 43.2 54.2 19.3% 0.0% 0.0% 0.0% 6.34sec 179294 299.67sec
Venthyr_Nadjia Venthyr_Nadjia rain_of_fire ticks -5740 266191 887 0.00 553 1106 17.0 0.0 19.3% 0.0% 0.0% 0.0% 16.86sec 266191 299.67sec
Venthyr_Nadjia Venthyr_Nadjia soul_fire 6353 153289 512 1.53 16918 33698 5.6 7.7 18.4% 0.0% 0.0% 0.0% 49.55sec 153289 299.67sec
Venthyr_Nadjia Venthyr_Nadjia summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
Venthyr_Nadjia Venthyr_Nadjia summon_infernal 1122 24119 80 1.20 3348 6696 2.0 6.0 20.1% 0.0% 0.0% 0.0% 180.71sec 24119 299.67sec
Venthyr_Nadjia Venthyr_Nadjia_infernal immolation 20153 213704 3562 117.00 1529 3061 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.50sec 213704 60.00sec
Venthyr_Nadjia Venthyr_Nadjia_infernal melee 0 15906 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.26sec 22721 60.00sec
Venthyr_Nadjia Venthyr_Nadjia_imp firebolt 3110 157440 525 18.90 1395 2790 95.1 94.4 19.6% 0.0% 0.0% 0.0% 3.15sec 157440 299.67sec
Venthyr_Theotar Venthyr_Theotar cataclysm 152108 237749 793 5.80 6879 13749 9.7 29.0 19.2% 0.0% 0.0% 0.0% 32.39sec 237749 299.67sec
Venthyr_Theotar Venthyr_Theotar channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.23sec 0 299.67sec
Venthyr_Theotar Venthyr_Theotar channel_demonfire_tick 196448 318171 1062 110.16 484 971 0.0 550.2 19.4% 0.0% 0.0% 0.0% 0.00sec 318171 299.67sec
Venthyr_Theotar Venthyr_Theotar chaos_bolt 116858 419643 1400 9.04 0 9293 22.7 45.2 100.0% 0.0% 0.0% 0.0% 12.96sec 419643 299.67sec
Venthyr_Theotar Venthyr_Theotar internal_combustion 266134 144916 484 8.97 2708 5410 44.8 44.8 19.6% 0.0% 0.0% 0.0% 12.93sec 144916 299.67sec
Venthyr_Theotar Venthyr_Theotar conflagrate 17962 247014 824 11.15 3727 7413 37.0 55.7 19.2% 0.0% 0.0% 0.0% 7.92sec 247014 299.67sec
Venthyr_Theotar Venthyr_Theotar havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.21sec 0 299.67sec
Venthyr_Theotar Venthyr_Theotar immolate 348 66336 221 7.04 1580 3164 28.1 35.2 19.4% 0.0% 0.0% 0.0% 10.33sec 495789 299.67sec
Venthyr_Theotar Venthyr_Theotar immolate ticks -348 429453 1432 69.18 1041 2079 28.1 345.9 19.3% 0.0% 0.0% 0.0% 10.33sec 495789 299.67sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.81sec 0 299.67sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe_impact 322167 9274 31 2.79 558 1116 0.0 13.9 19.2% 0.0% 0.0% 0.0% 0.00sec 9274 299.67sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe_dot ticks -322170 58643 195 20.32 484 967 0.0 101.6 19.3% 0.0% 0.0% 0.0% 0.00sec 58643 299.67sec
Venthyr_Theotar Venthyr_Theotar incinerate 29722 176807 590 10.44 2848 5666 41.6 52.2 19.2% 0.0% 0.0% 0.0% 6.55sec 176807 299.67sec
Venthyr_Theotar Venthyr_Theotar rain_of_fire ticks -5740 261312 871 0.00 569 1136 16.3 0.0 19.2% 0.0% 0.0% 0.0% 17.43sec 261312 299.67sec
Venthyr_Theotar Venthyr_Theotar soul_fire 6353 153689 513 1.51 17173 34516 5.6 7.5 18.5% 0.0% 0.0% 0.0% 49.46sec 153689 299.67sec
Venthyr_Theotar Venthyr_Theotar summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
Venthyr_Theotar Venthyr_Theotar summon_infernal 1122 23939 80 1.20 3348 6696 2.0 6.0 19.2% 0.0% 0.0% 0.0% 180.49sec 23939 299.67sec
Venthyr_Theotar Venthyr_Theotar_infernal immolation 20153 194930 3249 117.00 1395 2790 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 194930 60.00sec
Venthyr_Theotar Venthyr_Theotar_infernal melee 0 15943 266 41.00 326 651 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.25sec 22773 60.00sec
Venthyr_Theotar Venthyr_Theotar_imp firebolt 3110 153792 513 18.52 1395 2790 93.2 92.5 19.2% 0.0% 0.0% 0.0% 3.21sec 153792 299.67sec
destruction destruction cataclysm 152108 231152 771 5.79 6704 13427 9.6 28.9 19.2% 0.0% 0.0% 0.0% 32.54sec 231152 299.67sec
destruction destruction channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.22sec 0 299.67sec
destruction destruction channel_demonfire_tick 196448 308157 1028 110.12 470 942 0.0 550.0 19.2% 0.0% 0.0% 0.0% 0.00sec 308157 299.67sec
destruction destruction chaos_bolt 116858 374517 1250 8.80 0 8524 22.1 43.9 100.0% 0.0% 0.0% 0.0% 13.09sec 374517 299.67sec
destruction destruction internal_combustion 266134 136134 454 8.69 2629 5266 43.4 43.4 19.3% 0.0% 0.0% 0.0% 13.09sec 136134 299.67sec
destruction destruction conflagrate 17962 240040 801 11.22 3599 7181 37.0 56.0 19.1% 0.0% 0.0% 0.0% 7.96sec 240040 299.67sec
destruction destruction havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.37sec 0 299.67sec
destruction destruction immolate 348 63863 213 7.01 1533 3076 28.0 35.0 18.9% 0.0% 0.0% 0.0% 10.38sec 482722 299.67sec
destruction destruction immolate ticks -348 418859 1396 69.28 1014 2028 28.0 346.4 19.2% 0.0% 0.0% 0.0% 10.38sec 482722 299.67sec
destruction destruction incinerate 29722 182508 609 11.65 2626 5263 46.8 58.2 19.4% 0.0% 0.0% 0.0% 5.88sec 182508 299.67sec
destruction destruction rain_of_fire ticks -5740 267079 890 0.00 553 1105 17.1 0.0 19.3% 0.0% 0.0% 0.0% 16.86sec 267079 299.67sec
destruction destruction soul_fire 6353 153343 512 1.51 17004 34019 5.6 7.5 19.6% 0.0% 0.0% 0.0% 49.54sec 153343 299.67sec
destruction destruction summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.67sec
destruction destruction summon_infernal 1122 23984 80 1.20 3348 6696 2.0 6.0 19.4% 0.0% 0.0% 0.0% 180.56sec 23984 299.67sec
destruction destruction_infernal immolation 20153 194940 3249 117.00 1395 2790 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 194940 60.00sec
destruction destruction_infernal melee 0 15965 266 41.00 326 651 41.0 41.0 19.6% 0.0% 0.0% 0.0% 5.25sec 22805 60.00sec
destruction destruction_imp firebolt 3110 153974 514 18.52 1395 2790 93.2 92.5 19.3% 0.0% 0.0% 0.0% 3.21sec 153974 299.67sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
54201.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 54.4sec 12.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 142.4s

Stack Uptimes

  • Health Decade (0 - 10)_1:12.79%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.1sec 8.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 43.0s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.69%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 30.1sec 10.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 42.6s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.13%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 30.3sec 10.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.3s / 39.9s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.22%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.4sec 11.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.8s / 39.2s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.27%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 34.2sec 11.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.2s / 41.2s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.57%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.3sec 11.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.1s / 43.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.59%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.3sec 10.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.8s / 43.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.58%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 22.4sec 7.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.2s / 31.6s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.57%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 25.9sec 5.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.8s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.90%
infernal: Infernal Brand 2.0 39.0 175.5sec 5.3sec 37.5sec 25.31% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 185.1s
  • trigger_min/max:1.3s / 155.7s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.78%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 175.5sec 5.3sec 37.5sec 25.31% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 187.9s
  • trigger_min/max:1.3s / 158.5s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.78%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 175.7sec 5.3sec 37.5sec 25.31% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 186.4s
  • trigger_min/max:1.3s / 157.0s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.78%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 175.4sec 5.3sec 37.5sec 25.31% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 185.9s
  • trigger_min/max:1.3s / 156.5s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.78%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 175.5sec 5.3sec 37.5sec 25.31% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Necrolord_Marileth_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 187.4s
  • trigger_min/max:1.3s / 158.0s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.78%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 19.2 17.8 15.5sec 8.0sec 12.5sec 80.10% 0.00% 17.8 (17.8) 18.4

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 39.9s
  • trigger_min/max:2.1s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.0s

Stack Uptimes

  • roaring_blaze_1:80.10%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.4 17.5 15.4sec 8.0sec 12.3sec 79.53% 0.00% 17.5 (17.5) 18.6

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 40.9s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • roaring_blaze_1:79.53%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.3 17.6 15.4sec 8.0sec 12.4sec 79.51% 0.00% 17.6 (17.6) 18.5

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 46.8s
  • trigger_min/max:2.1s / 24.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.0s

Stack Uptimes

  • roaring_blaze_1:79.51%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.2 17.7 15.5sec 8.0sec 12.4sec 79.28% 0.00% 17.7 (17.7) 18.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.9s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.1s

Stack Uptimes

  • roaring_blaze_1:79.28%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.2 17.6 15.4sec 8.0sec 12.4sec 79.67% 0.00% 17.6 (17.6) 18.5

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.2s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.3s

Stack Uptimes

  • roaring_blaze_1:79.67%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.5 18.5 16.1sec 7.9sec 12.9sec 79.92% 0.00% 18.5 (18.5) 17.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 52.7s
  • trigger_min/max:1.9s / 23.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.2s

Stack Uptimes

  • roaring_blaze_1:79.92%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.9 20.0 16.8sec 7.8sec 13.7sec 81.40% 0.00% 20.0 (20.0) 17.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 39.8s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s

Stack Uptimes

  • roaring_blaze_1:81.40%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.3 18.5 16.3sec 8.0sec 12.9sec 78.45% 0.00% 18.5 (18.5) 17.5

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.9s
  • trigger_min/max:1.9s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s

Stack Uptimes

  • roaring_blaze_1:78.45%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.2 18.6 16.3sec 8.0sec 12.9sec 78.59% 0.00% 18.6 (18.6) 17.4

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.2s
  • trigger_min/max:1.9s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.5s

Stack Uptimes

  • roaring_blaze_1:78.59%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.0 18.9 16.6sec 8.0sec 13.0sec 78.42% 0.00% 18.9 (18.9) 17.3

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 49.9s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 42.9s

Stack Uptimes

  • roaring_blaze_1:78.42%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.8 17.9 15.7sec 8.0sec 12.5sec 78.33% 0.00% 17.9 (17.9) 18.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 47.8s
  • trigger_min/max:1.9s / 25.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.4s

Stack Uptimes

  • roaring_blaze_1:78.33%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
Fluffy_Pillow Damage Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 520
Mean 57754.72
Minimum 55827.18
Maximum 59911.44
Spread ( max - min ) 4084.26
Range [ ( max - min ) / 2 * 100% ] 3.54%
Standard Deviation 907.9333
5th Percentile 56429.91
95th Percentile 59259.28
( 95th Percentile - 5th Percentile ) 2829.37
Mean Distribution
Standard Deviation 39.8155
95.00% Confidence Interval ( 57676.68 - 57832.76 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 950
0.1 Scale Factor Error with Delta=300 7038
0.05 Scale Factor Error with Delta=300 28149
0.01 Scale Factor Error with Delta=300 703707
HPS
Fluffy_Pillow Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 37
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 19362233 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
28591.3 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 56.0sec 13.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 150.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.91%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.8sec 8.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 47.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.93%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 30.0sec 10.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.4s / 45.9s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.10%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.8sec 10.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.1s / 35.2s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.05%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.4s / 41.7s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.68%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.6sec 12.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.0s / 49.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.36%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.4sec 11.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.5s / 48.5s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.63%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 29.0sec 9.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.4s / 37.9s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.78%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 18.3sec 6.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.9s / 26.5s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.18%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 24.9sec 5.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.4s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.54%
Havoc 9.6 0.0 32.3sec 32.4sec 11.8sec 37.80% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.80%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 31.9sec 32.0sec 11.8sec 38.00% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:38.00%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 31.9sec 32.0sec 11.8sec 37.96% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 39.9s
  • trigger_min/max:30.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.96%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.0sec 32.1sec 11.8sec 37.95% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.4s
  • trigger_min/max:30.0s / 40.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.95%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 31.9sec 32.0sec 11.8sec 37.99% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.99%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.86% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.86%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.2sec 11.8sec 37.88% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.88%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.98% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.98%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.89% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.8s
  • trigger_min/max:30.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.89%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.3sec 32.4sec 11.8sec 37.76% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 40.0s
  • trigger_min/max:30.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.76%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.93% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s

Stack Uptimes

  • havoc_1:37.93%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 10.5 8.5 29.1sec 15.5sec 11.3sec 39.51% 0.00% 8.5 (8.5) 10.1

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 61.2s
  • trigger_min/max:2.4s / 59.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s

Stack Uptimes

  • roaring_blaze_1:39.51%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 9.1 28.6sec 14.8sec 11.6sec 41.31% 0.00% 9.1 (9.1) 10.2

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.2s
  • trigger_min/max:2.4s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.31%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 9.1 28.6sec 14.9sec 11.6sec 41.28% 0.00% 9.1 (9.1) 10.2

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.28%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 9.1 28.8sec 14.9sec 11.6sec 41.04% 0.00% 9.1 (9.1) 10.2

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.7s
  • trigger_min/max:2.4s / 66.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.04%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.2 28.8sec 14.8sec 11.8sec 41.40% 0.00% 9.2 (9.2) 10.2

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 41.9s
  • trigger_min/max:2.4s / 40.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.40%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 8.5 29.9sec 15.8sec 11.4sec 38.86% 0.00% 8.5 (8.5) 9.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.3s
  • trigger_min/max:2.4s / 41.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 18.2s

Stack Uptimes

  • roaring_blaze_1:38.86%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.7 8.0 28.4sec 15.7sec 11.0sec 39.49% 0.00% 8.0 (8.0) 10.4

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 65.4s
  • trigger_min/max:2.4s / 62.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.49%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.2 6.8 27.0sec 16.3sec 10.6sec 39.68% 0.00% 6.8 (6.8) 10.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 63.8s
  • trigger_min/max:2.4s / 60.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.68%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.2 7.0 26.9sec 16.2sec 10.7sec 40.05% 0.00% 7.0 (7.0) 10.9

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.4s
  • trigger_min/max:2.4s / 66.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:40.05%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 9.8 29.8sec 14.7sec 12.1sec 41.47% 0.00% 9.8 (9.8) 9.9

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.0s
  • trigger_min/max:2.4s / 38.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.4s

Stack Uptimes

  • roaring_blaze_1:41.47%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 12.0 6.5 24.9sec 15.9sec 10.4sec 41.90% 0.00% 6.5 (6.5) 11.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.9s
  • trigger_min/max:2.4s / 63.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s

Stack Uptimes

  • roaring_blaze_1:41.90%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
enemy2 Damage Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 520
Mean 30507.33
Minimum 29265.30
Maximum 32416.10
Spread ( max - min ) 3150.81
Range [ ( max - min ) / 2 * 100% ] 5.16%
Standard Deviation 659.7826
5th Percentile 29609.58
95th Percentile 31682.42
( 95th Percentile - 5th Percentile ) 2072.85
Mean Distribution
Standard Deviation 28.9334
95.00% Confidence Interval ( 30450.62 - 30564.03 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1797
0.1 Scale Factor Error with Delta=300 3717
0.05 Scale Factor Error with Delta=300 14865
0.01 Scale Factor Error with Delta=300 371609
HPS
enemy2 Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 37
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 10198211 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
17327.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 57.4sec 13.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 155.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.57%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.7sec 8.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 49.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.95%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 28.3sec 9.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:3.9s / 48.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.46%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 27.6sec 9.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 42.9s

Stack Uptimes

  • Health Decade (30 - 40)_1:9.33%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.6sec 11.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.8s / 43.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.34%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.5sec 13.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.2s / 50.5s

Stack Uptimes

  • Health Decade (50 - 60)_1:13.01%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.5sec 12.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.5s / 49.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.65%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.1sec 10.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.1s / 46.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.50%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 15.3sec 5.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.3s / 23.8s

Stack Uptimes

  • Health Decade (80 - 90)_1:5.15%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 26.6sec 6.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.2s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:6.13%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 520
Mean 299.67
Minimum 240.65
Maximum 359.76
Spread ( max - min ) 119.11
Range [ ( max - min ) / 2 * 100% ] 19.87%
DPS
enemy3 Damage Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 520
Mean 18424.53
Minimum 17528.29
Maximum 19435.54
Spread ( max - min ) 1907.24
Range [ ( max - min ) / 2 * 100% ] 5.18%
Standard Deviation 432.4638
5th Percentile 17737.50
95th Percentile 19103.80
( 95th Percentile - 5th Percentile ) 1366.30
Mean Distribution
Standard Deviation 18.9648
95.00% Confidence Interval ( 18387.36 - 18461.70 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2117
0.1 Scale Factor Error with Delta=300 1597
0.05 Scale Factor Error with Delta=300 6387
0.01 Scale Factor Error with Delta=300 159656
HPS
enemy3 Healing Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 520
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 37
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 4869197 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.